ILF2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-24914

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-24914
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all ILF2 Antibodies »

Product Summary for ILF2 Antibody

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein ILF2 using the following amino acid sequence: PCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKPPEKKE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ILF2 Antibody

ILF2 Antibody Immunocytochemistry/Immunofluorescence: ILF2 Antibody [NBP3-24914]

Immunocytochemistry/Immunofluorescence: ILF2 Antibody [NBP3-24914]

Staining of human cell line HAP1 shows localization to nucleoplasm & cytosol.
ILF2 Antibody Western Blot: ILF2 Antibody [NBP3-24914]

Western Blot: ILF2 Antibody [NBP3-24914]

Analysis in human cell line RT-4 and human cell line U-251 MG.

Applications for ILF2 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml

Western Blot

0.04-0.4 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, pH 7.2, 40% glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ILF2

Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of the interleukin 2 gene. NFAT binds to a sequence in the interleukin 2 gene enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the smaller of which is the product of this gene. The encoded protein binds strongly to the 90 kDa protein and stimulates its ability to enhance gene expression. [provided by RefSeq]

Alternate Names

interleukin enhancer binding factor 2, 45kD, interleukin enhancer binding factor 2, 45kDa, interleukin enhancer-binding factor 2, MGC8391, NF45PRO3063, Nuclear factor of activated T-cells 45 kDa, nuclear factor of activated T-cells, 45-kDa

Gene Symbol

ILF2

Additional ILF2 Products

Product Documents for ILF2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ILF2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.