ILT4/CD85d/LILRB2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-98554

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-98554
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all LILRB2/CD85d/ILT4 Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is LILRB2 - C-terminal region. Peptide sequence MDTRAAASEAPQDVTYAQLHSLTLRRKATEPPPSQEREPPAEPSIYATLA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ILT4/CD85d/LILRB2 Antibody

Western Blot: ILT4/CD85d/LILRB2 Antibody [NBP1-98554]

Western Blot: ILT4/CD85d/LILRB2 Antibody [NBP1-98554]

Western Blot: ILT4/CD85d/LILRB2 Antibody [NBP1-98554] - Host: Rabbit. Target: LILRB2. Positive control (+): Human brain (BR). Negative control (-): 293T (2T). Antibody concentration: 1ug/ml
Western Blot: ILT4/CD85d/LILRB2 Antibody [NBP1-98554]

Western Blot: ILT4/CD85d/LILRB2 Antibody [NBP1-98554]

Western Blot: ILT4/CD85d/LILRB2 Antibody [NBP1-98554] - Human Fetal Brain Lysate 1.0ug/ml, Gel Concentration: 12%
Western Blot: ILT4/CD85d/LILRB2 Antibody [NBP1-98554]

Western Blot: ILT4/CD85d/LILRB2 Antibody [NBP1-98554]

Western Blot: ILT4/CD85d/LILRB2 Antibody [NBP1-98554] - Host: Rabbit. Target Name: LILRB2. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml

Applications for ILT4/CD85d/LILRB2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LILRB2/CD85d/ILT4

This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene.

Long Name

Leukocyte Immunoglobulin-like Receptor, Subfamily B (with TM and ITIM Domains), Member 5

Alternate Names

CD85d, ILT4, LIR2, MIR10

Gene Symbol

LILRB2

UniProt

NP_005865

Additional LILRB2/CD85d/ILT4 Products

Product Documents for ILT4/CD85d/LILRB2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ILT4/CD85d/LILRB2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.