Integrin alpha 5/CD49e Antibody (8F2O6)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15645

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-15645-100ul
NBP3-15645-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Flow Cytometry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8F2O6

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Integrin alpha 5/CD49e Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 950-1049 of human Integrin alpha 5/CD49e (P08648). HQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Integrin alpha 5/CD49e Antibody (8F2O6)

Western Blot: Integrin alpha 5/CD49e Antibody (8F2O6) [NBP3-15645]

Western Blot: Integrin alpha 5/CD49e Antibody (8F2O6) [NBP3-15645]

Western Blot: Integrin alpha 5/CD49e Antibody (8F2O6) [NBP3-15645] - Analysis of extracts of various cell lines, using Integrin alpha 5/CD49e (ITGA5/CD49e) antibody (NBP3-15645) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunohistochemistry-Paraffin: Integrin alpha 5/CD49e Antibody (8F2O6) [NBP3-15645]

Immunohistochemistry-Paraffin: Integrin alpha 5/CD49e Antibody (8F2O6) [NBP3-15645]

Immunohistochemistry-Paraffin: Integrin alpha 5/CD49e Antibody (8F2O6) [NBP3-15645] - Human placenta using Integrin alpha 5/CD49e (ITGA5/CD49e) Rabbit mAb (NBP3-15645) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Flow Cytometry: Integrin alpha 5/CD49e Antibody (8F2O6) [NBP3-15645]

Flow Cytometry: Integrin alpha 5/CD49e Antibody (8F2O6) [NBP3-15645]

Flow Cytometry: Integrin alpha 5/CD49e Antibody (8F2O6) [NBP3-15645] - Daudi cells were stained with Rabbit IgG isotype control (AC042, 10 ug/ml, blue line) or Integrin alpha 5 (ITGA5/CD49e) Rabbit mAb (5 ug/ml green line), followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb(1:600 dilution) staining. Non-fluorescently stained Daudi cells were used as blank control (red line).
View 5 more images

Applications for Integrin alpha 5/CD49e Antibody (8F2O6)

Application
Recommended Usage

Flow Cytometry

1:50 - 1:200

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Integrin alpha 5/CD49e

CD49e is a type I integral membrane glycoprotein, known as alpha5 integrin, VLA-5 alpha chain. It forms noncovalent heterodimer with integrin beta1 (CD29). CD49e contains two disulfide-linked subunits of 135 kDa and 24 kDa, and is mainly expressed on thymocytes, activated lymphocytes, endothelial cells, osteoblasts, melanoma, and some myeloid leukemia cells. CD49e/CD29 complex binds to fibronection and neural adhesion molecule L1. It mediates monocytes migration, involves in the regulation of cells survival and apoptosis, and co-stimulates T cell activation.

Alternate Names

CD49e, ITGA5, VLA-5 alpha

Gene Symbol

ITGA5

Additional Integrin alpha 5/CD49e Products

Product Documents for Integrin alpha 5/CD49e Antibody (8F2O6)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Integrin alpha 5/CD49e Antibody (8F2O6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.