Integrin alpha 6/CD49f Antibody (7U5Z0)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16085

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16085-100ul
NBP3-16085-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7U5Z0

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Integrin alpha 6/CD49f Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 481-591 of human Integrin alpha 6/CD49f (NP_001073286.1). IDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEP

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Integrin alpha 6/CD49f Antibody (7U5Z0)

Western Blot: Integrin alpha 6/CD49f Antibody (7U5Z0) [NBP3-16085]

Western Blot: Integrin alpha 6/CD49f Antibody (7U5Z0) [NBP3-16085]

Western Blot: Integrin alpha 6/CD49f Antibody (2R5F1) [NBP3-16085] - Western blot analysis of extracts of various cell lines, using Integrin alpha 6/CD49f antibody (NBP3-16085) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
Western Blot: Integrin alpha 6/CD49f Antibody (7U5Z0) [NBP3-16085]

Western Blot: Integrin alpha 6/CD49f Antibody (7U5Z0) [NBP3-16085]

Western Blot: Integrin alpha 6/CD49f Antibody (2R5F1) [NBP3-16085] - Western blot analysis of extracts of various cell lines, using Integrin alpha 6/CD49f antibody (NBP3-16085) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 180s.

Applications for Integrin alpha 6/CD49f Antibody (7U5Z0)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Integrin alpha 6/CD49f

The ITGA6 protein product is the integrin alpha chain alpha 6. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. For example, alpha 6 may combine with beta 4 in the integrin referred to as TSP180, or with beta 1 in the integrin VLA-6. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Alternate Names

CD49f, ITGA6, Platelet gpl, VLA-6

Gene Symbol

ITGA6

Additional Integrin alpha 6/CD49f Products

Product Documents for Integrin alpha 6/CD49f Antibody (7U5Z0)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Integrin alpha 6/CD49f Antibody (7U5Z0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.