Kv9.2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-10168

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-10168-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all Kv9.2 Antibodies »

Product Summary for Kv9.2 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Kv9.2 (NP_001258633.1). Peptide sequence GINEFFIDSCCSYSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDA

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Kv9.2 Antibody

Western Blot: Kv9.2 Antibody [NBP3-10168]

Western Blot: Kv9.2 Antibody [NBP3-10168]

Western Blot: Kv9.2 Antibody [NBP3-10168] - Western blot analysis of Kv9.2 in Mouse Skeletal Muscle lysates. Antibody dilution at 1ug/ml

Applications for Kv9.2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Kv9.2

Voltage-gated K+ channels in the plasma membrane control the repolarization and the frequency of action potentials in neurons, muscles and other excitable cells. The KV gene family encodes more than 30 proteins that comprise the subunits of the K+ channels, and they vary in their gating and permeation properties, subcellular distribution and expression patterns. Functional KV channels assemble as tetramers consisting of pore-forming alpha subunits (KV), which include the KV1, KV2, KV3, KV4 and KV9 proteins, and accessory or KV-subunits that modify the gating properties of the coexpressed KV subunits. KV9.2 is a K+ channel subunit that reduces the ion flow and regulates channel activity. It localizes to the cell membrane and, in the absence of KCNB1, KV9.2 may not reach the plasma membrane and may remain in an intracellular compartment.

Alternate Names

Delayed-rectifier K(+) channel alpha subunit 2, KIAA1144, KV9.2, potassium voltage-gated channel subfamily S member 2, potassium voltage-gated channel, delayed-rectifier, subfamily S, member 2, Voltage-gated potassium channel subunit Kv9.2

Gene Symbol

KCNS2

Additional Kv9.2 Products

Product Documents for Kv9.2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Kv9.2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.