Lactate Dehydrogenase B Antibody (6B5I2)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16569

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16569-100ul
NBP3-16569-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunoprecipitation, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6B5I2

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Lactate Dehydrogenase B/LDHB Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lactate Dehydrogenase B (P07195). MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Lactate Dehydrogenase B Antibody (6B5I2)

Western Blot: Lactate Dehydrogenase B Antibody (6B5I2) [NBP3-16569]

Western Blot: Lactate Dehydrogenase B Antibody (6B5I2) [NBP3-16569]

Western Blot: Lactate Dehydrogenase B Antibody (6B5I2) [NBP3-16569] - Western blot analysis of extracts of various cell lines, using Lactate Dehydrogenase B Rabbit mAb (NBP3-16569) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.
Immunohistochemistry-Paraffin: Lactate Dehydrogenase B Antibody (6B5I2) [NBP3-16569]

Immunohistochemistry-Paraffin: Lactate Dehydrogenase B Antibody (6B5I2) [NBP3-16569]

Immunohistochemistry-Paraffin: Lactate Dehydrogenase B Antibody (6B5I2) [NBP3-16569] - Immunohistochemistry of paraffin-embedded human appendix using Lactate Dehydrogenase B Rabbit mAb (NBP3-16569) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Lactate Dehydrogenase B Antibody (6B5I2) [NBP3-16569]

Immunohistochemistry-Paraffin: Lactate Dehydrogenase B Antibody (6B5I2) [NBP3-16569]

Immunohistochemistry-Paraffin: Lactate Dehydrogenase B Antibody (6B5I2) [NBP3-16569] - Immunohistochemistry of paraffin-embedded rat ovary using Lactate Dehydrogenase B Rabbit mAb (NBP3-16569) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
View 1 more images

Applications for Lactate Dehydrogenase B Antibody (6B5I2)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:10-1:500

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Lactate Dehydrogenase B/LDHB

Lactate dehydrogenase (LDH) is an ubiquitous enzyme commonly found in wide variety of organisms, including plants and microbes. LDH is involved in the interconversion of the pyruvate and NADH to lactate and NAD+. It is also called Hydroxybutyrate Dehydrogenase (HBD), because it can catalyze the oxidation of hydroxybutyrate (1). In mammals, three types of LDH subunits (35 kDa) are encoded by the genes Ldh-A, Ldh-B, and Ldh-C. All LDH subunits can combine to form various terameric isoenzymes (140 kDa). Lactate dehydrogenase B (LDH-B, heart subunit, LDH-H) is involved in the conversion of L-lactate and NAD to pryruvate and NADH and it is predominantly localized in the heart tissue. Similar to other LDH subunit, LDH-B is considered to be an important marker for germ cell tumor (2).

Alternate Names

Epididymis Secretory Protein Li 281, HEL-S-281, LDH-H, LDHB, LDHBD, Renal Carcinoma Antigen NY-REN-46, TRG-5

Gene Symbol

LDHB

Additional Lactate Dehydrogenase B/LDHB Products

Product Documents for Lactate Dehydrogenase B Antibody (6B5I2)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Lactate Dehydrogenase B Antibody (6B5I2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.