Laminin beta 1 Antibody (6I9T4)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16392

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16392-100ul
NBP3-16392-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6I9T4

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Laminin beta 1 Antibodies »

Product Summary for Laminin beta 1 Antibody (6I9T4)

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1687-1786 of human Laminin beta 1 (P07942). KKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLLKDLERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Laminin beta 1 Antibody (6I9T4)

Western Blot: Laminin beta 1 Antibody (6I9T4) [NBP3-16392]

Western Blot: Laminin beta 1 Antibody (6I9T4) [NBP3-16392]

Western Blot: Laminin beta 1 Antibody (6I9T4) [NBP3-16392] - Western blot analysis of extracts of Rat lung, using Laminin beta 1 Rabbit mAb (NBP3-16392) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Immunocytochemistry/ Immunofluorescence: Laminin beta 1 Antibody (6I9T4) [NBP3-16392]

Immunocytochemistry/ Immunofluorescence: Laminin beta 1 Antibody (6I9T4) [NBP3-16392]

Immunocytochemistry/Immunofluorescence: Laminin beta 1 Antibody (6I9T4) [NBP3-16392] - Immunofluorescence analysis of U-2 OS cells using Laminin beta 1 Rabbit mAb (NBP3-16392) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: Laminin beta 1 Antibody (6I9T4) [NBP3-16392]

Western Blot: Laminin beta 1 Antibody (6I9T4) [NBP3-16392]

Western Blot: Laminin beta 1 Antibody (6I9T4) [NBP3-16392] - Western blot analysis of extracts of Mouse heart, using Laminin beta 1 Rabbit mAb (NBP3-16392) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
View 3 more images

Applications for Laminin beta 1 Antibody (6I9T4)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Laminin beta 1

Laminins are essential and abundant structural non-collagenous glycoproteins localizing to basement membranes. Basement membranes (cell-associated extracellular matrices (ECMs)) are polymers of Laminins with stabilizing type IV collagen networks, nidogen and several proteoglycans. Basement membranes are found under epithelial layers, around the endothelium of blood vessels and surrounding muscle, peripheral nerve and fat cells. Formation of basement membranes influences cell proliferation, phenotype, migration, gene expression and tissue architecture. Each Laminin is a heterotrimer of alpha, beta and gamma chain subunits that undergoes cell-secretion and incorporation into the ECM. Laminins can self-assemble and bind to other matrix macromolecules, and have unique and shared cell interactions mediated by Integrins, dystroglycan and cognate Laminin receptors. The human Laminin gamma-1 gene maps to chromosome 1q31 and is ubiquitously expressed in tissues that produce basement membranes.

Alternate Names

CLM, cutis laxa with marfanoid phenotype, Laminin B1 chain, laminin subunit beta-1, laminin, beta 1, Laminin-1 subunit beta, Laminin-10 subunit beta, Laminin-12 subunit beta, Laminin-2 subunit beta, Laminin-6 subunit beta, Laminin-8 subunit beta, MGC142015

Gene Symbol

LAMB1

Additional Laminin beta 1 Products

Product Documents for Laminin beta 1 Antibody (6I9T4)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Laminin beta 1 Antibody (6I9T4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.