Mammaglobin B Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-87736

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-87736
NBP1-87736-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Mammaglobin B Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Mammaglobin B Antibody

Western Blot: Mammaglobin B Antibody [NBP1-87736]

Western Blot: Mammaglobin B Antibody [NBP1-87736]

Western Blot: Mammaglobin B Antibody [NBP1-87736] - Analysis in control (vector only transfected HEK293T lysate) and SCGB2A1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Mammaglobin B Antibody [NBP1-87736]

Immunohistochemistry-Paraffin: Mammaglobin B Antibody [NBP1-87736]

Immunohistochemistry-Paraffin: Mammaglobin B Antibody [NBP1-87736] - Staining in human cervix, uterine and testis tissues using anti-SCGB2A1 antibody. Corresponding SCGB2A1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Mammaglobin B Antibody [NBP1-87736]

Immunohistochemistry-Paraffin: Mammaglobin B Antibody [NBP1-87736]

Immunohistochemistry-Paraffin: Mammaglobin B Antibody [NBP1-87736] - Staining of human cervix, uterine shows high expression.
View 1 more images

Applications for Mammaglobin B Antibody

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Mammaglobin B

Secretoglobins (also called lipophilins or mammaglobins) are small secreted proteins of endocrine-responsive organs and mucosal epithelia that form multimeric complexes and correlate with the development of various human cancers. Lipophilin A and Lipophilin B are orthologs of prostatein (estramustine- binding protein), the major secretory glycoprotein of the rat ventral prostate gland. Lipophilin A, also designated LIPA, LPHA and secretoglobin, family 1D, member 1 (SCGB1D1), is a component of a heterodimeric molecule present in human tears. Lipophilin B, also designated LIPB, LPHB and secretoglobin, family 1D, member 2 (SCGB1D2), mRNA can be overexpressed in breast tumors and shows a high degree of correlation with the mRNA expression profile of mammaglobin. Histological detection in breast tissue of Mammaglobin A, also designated MGB1 and secretoglobin, family 2A, member 2 (SCGB2A2) and Mammaglobin B, also designated MGB2, Lipophilin C, LPHC, UGB3 and SCGB2A2, is a reliable diagnostic marker for breast tumors

Alternate Names

lacryglobin, LIPHC, lipophilin C, Lipophilin-C, LPHC, mammaglobin 2, mammaglobin B, Mammaglobin-2, MGB2mammaglobin-B, MGC71973, Secretoglobin family 2A member 1, secretoglobin, family 2A, member 1, UGB3mammaglobin-2

Gene Symbol

SCGB2A1

Additional Mammaglobin B Products

Product Documents for Mammaglobin B Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Mammaglobin B Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.