Skip to main content

MBP Antibody (7D2) [Alexa Fluor® 405]

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-05204AF405

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human, Mouse, Rat, Porcine, Bovine, Equine

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Western Blot

Label

Alexa Fluor 405 (Excitation = 405 nm, Emission = 421 nm)

Antibody Source

Monoclonal Mouse IgG1 Clone # 7D2

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5kDa sequence.

Specificity

The MBP Antibody (7D2) antibody binds only the 21.5kDa and 18.5kDa rat MBP isotypes, but all four isotypes of human and bovine MBP.

Marker

Oligodendrocyte Marker, Myelin Marker

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1

Applications for MBP Antibody (7D2) [Alexa Fluor® 405]

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: MBP

Myelin Basic Protein (MBP) functions in the nervous system in myelination and is expressed in oligodendrocytes following differentiation. There are numerous isoforms generated by differential splicing events and post-translational modifications that have specialized functions. These functions include participation in signaling pathways prior to myelination, myelination or the re-myelination process following neural injury.

Long Name

Myelin Basic Protein

Alternate Names

Hmbpr, mld, shi

Gene Symbol

MBP

Additional MBP Products

Product Documents for MBP Antibody (7D2) [Alexa Fluor® 405]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MBP Antibody (7D2) [Alexa Fluor® 405]



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...