MCT2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-85265

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-85265-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Simple Western, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all MCT2 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human MCT2. Peptide sequence: LAGKLVDLTGEYKYMYMSCGAIVVAASVWLLIGNAINYRLLAKERKEENA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MCT2 Antibody

Western Blot: MCT2 Antibody [NBP2-85265]

Western Blot: MCT2 Antibody [NBP2-85265]

Western Blot: MCT2 Antibody [NBP2-85265] - Host: Rabbit. Target Name: SLC16A7. Sample Type: Fetal Heart lysates. Antibody Dilution: 1.0ug/ml
Western Blot: MCT2 Antibody [NBP2-85265]

Western Blot: MCT2 Antibody [NBP2-85265]

Western Blot: MCT2 Antibody [NBP2-85265] - Host: Rabbit. Target: SLC16A7. Positive control (+): Human Fetal Heart (HE). Negative control (-): Human Brain (BR). Antibody concentration: 1ug/ml

Applications for MCT2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Application Notes
See Simple Western Antibody Database for Simple Western validation: tested in mouse eye tissue from D2 and D2G ON mouse model; antibody dilution of 1:50; separated by size

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MCT2

Lactic acid and pyruvate transport across plasma membranes is catalyzed by members of the proton-linked monocarboxylate transporter (MCT) family, which has been designated solute carrier family 16. Each MCT appears to have slightly different substrate and inhibitor specificities and transport kinetics, which are related to the metabolic requirements of the tissues in which it is found. MCT2 is a high affinity transporter that catalyzes the rapid transport of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate across the plasma membrane.

Long Name

Monocarboxylate transporter 2

Alternate Names

MCT 2, SLC16A7

Gene Symbol

SLC16A7

Additional MCT2 Products

Product Documents for MCT2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MCT2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.