MUC5AC Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-25001

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-25001
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all MUC5AC Antibodies »

Product Summary for MUC5AC Antibody

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein MUC5AC using the following amino acid sequence: LLSHNTKLTPMEFGNLQKMDDPTEQCQDPVPEPPRNCSTGFGICEELLHGQLFSGCVALVDVGSYLEACRQDLCFCE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MUC5AC Antibody

MUC5AC Antibody Immunohistochemistry-Paraffin: MUC5AC Antibody [NBP3-25001]

Immunohistochemistry-Paraffin: MUC5AC Antibody [NBP3-25001]

Staining of human stomach shows strong positivity was observed in subset of glandular cells.

Applications for MUC5AC Antibody

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, we recommend using Heat-Induced Epitope Retrieval (HIER) with a pH level of 6. This optimized retrieval method ensures the best results for your experiments.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, pH 7.2, 40% glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MUC5AC

Mucin 5, subtype AC (MUC5AC) is a gel-forming secreted mucin that functions as a protective barrier on surface of epithelial tissues (1-2). MUC5AC is expressed primarily by goblet cells of the surface epithelium, including in the stomach, respiratory tract, gall bladder, endocervix, and endometrium (1-3). Human MUC5AC is located on chromosome 11p15.5, consisting of 5654 amino acids and has a N-terminus, tandem-repeat region (TRR), and a C-terminus, with a theoretical molecular weight of ~585 kDa (1-4). More specifically, the N-terminus contains four von Willebrand factor type D domains, where D1 also has a leucine zipper pattern (1). The TRR is further divided into nine CysD domains and four PTS-rich tandem repeats (1). Finally, the C-terminus has a D4-, B-, C-, and CK-domain (1). The TRR is a site of heavy O-glycosylation that functions in gel and polypeptide formation (1,3).

Given that MUC5AC is the primary mucin produced and secreted by cells lining airway, it is understandable that its expression is dysregulated in a number of respiratory diseases (1,3,5,6). For instance, MUC5AC is overexpressed in asthma and the protein is also more highly glycosylated, specifically fucosylated, in the disease state (1,3,7). Additionally, its overproduction is a key feature in chronic obstructive pulmonary disease (COPD) contributing to mucosal blockage (6). Multiple pathways are associated with overproduction of MUC5AC including NFkappaB, the primary pathway for production and secretion, and also the MAPK and STAT6 pathways (3). In addition to conventional, synthetic therapeutics agents, researchers are exploring natural MUC5AC inhibitors such as flavonoids, glycosides, and steroids to treat associated disorders (3).

References

1. Krishn, S. R., Ganguly, K., Kaur, S., & Batra, S. K. (2018). Ramifications of secreted mucin MUC5AC in malignant journey: a holistic view. Carcinogenesis. https://doi.org/10.1093/carcin/bgy019

2. Ballester, B., Milara, J., & Cortijo, J. (2019). Mucins as a New Frontier in Pulmonary Fibrosis. Journal of clinical medicine. https://doi.org/10.3390/jcm8091447

3. Samsuzzaman, M., Uddin, M. S., Shah, M. A., & Mathew, B. (2019). Natural inhibitors on airway mucin: Molecular insight into the therapeutic potential targeting MUC5AC expression and production. Life sciences. https://doi.org/10.1016/j.lfs.2019.05.041

4. Uniprot (P98088)

5. Li, J., & Ye, Z. (2020). The Potential Role and Regulatory Mechanisms of MUC5AC in Chronic Obstructive Pulmonary Disease. Molecules (Basel, Switzerland). https://doi.org/10.3390/molecules25194437

6. Bonser, L. R., & Erle, D. J. (2017). Airway Mucus and Asthma: The Role of MUC5AC and MUC5B. Journal of clinical medicine. https://doi.org/10.3390/jcm6120112

Alternate Names

gastric mucin, leB, lewis B blood group antigen, major airway glycoprotein, MUC5, mucin 5, subtypes A and C, tracheobronchial/gastric, mucin 5AC, oligomeric mucus/gel-forming, mucin 5AC, oligomeric mucus/gel-forming pseudogene, mucin-5 subtype AC, tracheobronchial, mucin-5AC, TBM, tracheobronchial mucin

Gene Symbol

MUC5AC

Additional MUC5AC Products

Product Documents for MUC5AC Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for MUC5AC Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.