Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (4Z7X1)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16242

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16242-100ul
NBP3-16242-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4Z7X1

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Muscle Phosphofructokinase/PFKM Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Fructose 6 Phosphate Kinase (P08237). FVHEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKAGKITDEEA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (4Z7X1)

Western Blot: Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (4Z7X1) [NBP3-16242]

Western Blot: Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (4Z7X1) [NBP3-16242]

Western Blot: Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (4Z7X1) [NBP3-16242] - Western blot analysis of extracts of various cell lines, using Muscle Phosphofructokinase/PFKM/PFK-1 Rabbit mAb (NBP3-16242) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Western Blot: Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (4Z7X1) [NBP3-16242]

Western Blot: Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (4Z7X1) [NBP3-16242]

Western Blot: Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (4Z7X1) [NBP3-16242] - Western blot analysis of extracts of various cell lines, using Muscle Phosphofructokinase/PFKM/PFK-1 Rabbit mAb (NBP3-16242) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Applications for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (4Z7X1)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Muscle Phosphofructokinase/PFKM

Phosphofructokinases (PFK) are regulatory glycolytic enzymes that convert fructose 6-phosphate and ATP into fructose 1,6-bisphosphate (through PFK-1), fructose 2,6-bisphosphate (through PFK-2) and ADP. Human PFK-1 is tetrameric and isoenzymes include PFK-1 muscle (PFKM, PFK-A), PFK-1 liver (PFKL, PFK-B) and PFK-1 platelet (PFKP, PFK-C, PFKF). PFK-1 is inhibited by ATP and citrate (from the tricarboxylic acid cycle). PFK-1 undergoes activation in the presence of elevated AMP. The most potent activator is fructose 2,6-bisphosphate, which is produced by PFK-2 from the same substrate, fructose 6-phosphate. PFK-2 is bifunctional and a key regulator for PFK-1. PFK-2 catalyzes the synthesis of fructose 2,6-bisphosphate and contains fructose 2,6-biphosphatase activity that catalyzes the degradation of fructose 2,6-bisphosphate. PFK-2 is dimeric and isoenzymes include PFK-2 liver (PFKFB1, PFRX), PFK-2 cardiac (PFKFB2), PFK-2 placental (PFKFB3, inducible PFK-2) and PFK-2 testis (PFKFB4).

Long Name

Phosphofructokinase, Muscle

Alternate Names

GSD7, PFK-1, PFK-A, PFKM, PFKX, Phosphofructokinase-1, Phosphofructokinase-M, Phosphohexokinase

Gene Symbol

PFKM

Additional Muscle Phosphofructokinase/PFKM Products

Product Documents for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (4Z7X1)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Muscle Phosphofructokinase/PFKM/PFK-1 Antibody (4Z7X1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.