NDUFA1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-38523

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-38523-100ul
NBP3-38523-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all NDUFA1 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human NDUFA1 (NP_004532.1).

Sequence:
MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NDUFA1 Antibody

NDUFA1 Antibody

Western Blot: NDUFA1 Antibody [NBP3-38523] -

Western Blot: NDUFA1 Antibody [NBP3-38523] - Western blot analysis of various lysates using NDUFA1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 30s.

Applications for NDUFA1 Antibody

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NDUFA1

The human NDUFA1 gene codes for an essential component of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. It has been noted that the N-terminal hydrophobic domain has the potential to be folded into an alpha-helix spanning the inner mitochondrial membrane with a C-terminal hydrophilic domain interacting with globular subunits of complex I. The highly conserved two-domain structure suggests that this feature is critical for the protein function and might act as an anchor for the NADH:ubiquinone oxidoreductase complex at the inner mitochondrial membrane. However, the NDUFA1 peptide is one of about 31 components of the "hydrophobic protein" (HP) fraction of complex I which is involved in proton translocation. Thus the NDUFA1 peptide may also participate in that function. [provided by RefSeq]

Alternate Names

CI-MWFEcomplex I MWFE subunit, Complex I-MWFE, MWFENADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1 (7.5kD, MWFE), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa, NADH oxidoreductase subunit MWFE, NADH:ubiquinone oxidoreductase (complex 1), NADH-ubiquinone oxidoreductase MWFE subunit, type I dehydrogenase, ZNF183

Gene Symbol

NDUFA1

Additional NDUFA1 Products

Product Documents for NDUFA1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for NDUFA1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.