NFkB p105/p50 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-35466

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-35466-100ul
NBP3-35466-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all NFkB p105/p50 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 41-365 of human NFkB p105/p50 (NP_001158884.1).

Sequence:
DFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

105 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NFkB p105/p50 Antibody

NFkB p105/p50 Antibody

Immunocytochemistry/ Immunofluorescence: NFkB p105/p50 Antibody [NBP3-35466] -

Immunocytochemistry/ Immunofluorescence: NFkB p105/p50 Antibody [NBP3-35466] - Immunofluorescence analysis of BALB-3T3 cells using NFkB p105/p50 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
NFkB p105/p50 Antibody

Western Blot: NFkB p105/p50 Antibody [NBP3-35466] -

Western Blot: NFkB p105/p50 Antibody [NBP3-35466] - Western blot analysis of lysates from Rat testis, using NFkB p105/p50 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.

Applications for NFkB p105/p50 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NFkB p105/p50

NFkB is a transcription regulator that is activated by various intra and extra cellular stimuli such as cytokines, oxidant free radicals, ultraviolet irradiation, and bacterial or viral products. NFkB is a family of transcription factors that consists of homo and heterodimers of NFkB1/p50 and RelA/p65 subunits, and controls a variety of cellular events including development and immune responses. All members share a conserved amino terminus domain that includes dimerization, nuclear localization, and DNA binding regions, and a carboxy terminal transactivation domain. Serines 529 and 536 in the transactivation domain of RelA/p65 are phosphorylated in response to several stimuli including phorbol ester, IL1 alpha and TNF alpha as mediated by IkB kinase and p38 MAPK. Serine 529 is located in a negatively charged region (amino acids 422-540) that is phosphorylated in response to phorbol myristate acetate plus calcium ionophore activation. Phosphorylation of serines 529 and 536 is critical for RelA/p65 transcriptional activity. Activated NFkB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFkB has been associated with a number of inflammatory diseases while persistent inhibition of NFkB leads to inappropriate immune cell development or delayed cell growth.

Alternate Names

DKFZp686C01211, DNA binding factor KBF1, DNA-binding factor KBF1, EBP-1, KBF1, NF-kappaB, NF-kappa-B, NF-kappabeta, NFKB-p105, NFKB-p50, nuclear factor kappa-B DNA binding subunit, nuclear factor NF-kappa-B p105 subunit, nuclear factor NF-kappa-B p50 subunit, nuclear factor of kappa light polypeptide gene enhancer in B-cells 1MGC54151, p105, p50

Gene Symbol

NFKB1

Additional NFkB p105/p50 Products

Product Documents for NFkB p105/p50 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for NFkB p105/p50 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.