NKG2A/CD159a/KLRC1 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-74093

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-74093
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

0.5 mg/ml

View all NKG2A/CD159a Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to the C terminal of KLRC1. Immunizing peptide sequence SHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKH. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for NKG2A/CD159a/KLRC1 Antibody - BSA Free

Western Blot: NKG2A/CD159a/KLRC1 Antibody [NBP1-74093]

Western Blot: NKG2A/CD159a/KLRC1 Antibody [NBP1-74093]

Western Blot: NKG2A/CD159a/KLRC1 Antibody [NBP1-74093] - Lane: MCF7 cell Lysate, Antibody Titration :1 ug/ml, and Gel concentration :12%

Applications for NKG2A/CD159a/KLRC1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NKG2A/CD159a

NK group 2 member A (NKG2A), also known as killer lectin like receptor c1 (KLRC1) and CD159a, is a ~38 kDa type II transmembrane protein belonging to the C-type lectin superfamily and plays a role in suppression of cytotoxic CD8+ T cell activity and functions as an immune checkpoint (1,2). NKG2A belongs to a group of natural killer (NK) cell inhibitor receptors (IRs) which includes killer immunoglobulin receptors (KIRs), lymphocyte activation gene-3 (LAG-3), T cell immunoreceptor with Ig and ITIM domains (TIGIT), programmed death ligand-1 (PD-1), and T cell immunoglobulin mucin-3 (TIM-3) (1,3). NKG2A is synthesized as a protein of 233 amino acids (aa) with a theoretical molecular weight of 26.3 kDa and is expressed on CD56hi NK cells, NKT cells, and some CD8+ alphabeta T cells (2,4). Together with CD94, NKG2A forms a heterodimer and acts as a receptor for the MHC Class I molecular human leukocyte antigen (HLA)-E (1-3). The NKG2A/CD94 receptor interaction with the HLA-E ligand results in phosphorylation of NKG2A's immunoreceptor tyrosine-based inhibition motifs (ITIMs), causing suppression of activating signals from immunoreceptor tyrosine-based activation motif (ITAM)- containing T cell receptors (TCR) or other activating receptors like NKG2D, via the intracellular phosphatase SHP1 (2,3,5). Overall, cancer cells utilize the NKG2A-HLA-E interaction and signaling to evade immune surveillance by NK cells and T cells (1-3,5-6).

Similar to cytotoxic T lymphocyte associated protein 4 (CTLA-4) and PD-1, NKG2A has become a prominent target for immune checkpoint blockade and cancer immunotherapy (1-3,5-6). Monalizumab is a novel IgG4 monoclonal antibody developed for blocking NKG2A's interaction with HLA-E and has shown promising results in clinical trials (1-3,5-6). In addition to being used as a single agent, it is being studied as a possible combination therapy with other blocking antibodies such as anti-PD-L1 and anti-epidermal growth factor receptor (EGFR) (2,5,6).

References

1. Alfarra, H., Weir, J., Grieve, S., & Reiman, T. (2020). Targeting NK Cell Inhibitory Receptors for Precision Multiple Myeloma Immunotherapy. Frontiers in immunology, 11, 575609. https://doi.org/10.3389/fimmu.2020.575609

2. Creelan, B. C., & Antonia, S. J. (2019). The NKG2A immune checkpoint - a new direction in cancer immunotherapy. Nature reviews. Clinical oncology, 16(5), 277-278. https://doi.org/10.1038/s41571-019-0182-8

3. Zaghi, E., Calvi, M., Marcenaro, E., Mavilio, D., & Di Vito, C. (2019). Targeting NKG2A to elucidate natural killer cell ontogenesis and to develop novel immune-therapeutic strategies in cancer therapy. Journal of leukocyte biology, 105(6), 1243-1251. https://doi.org/10.1002/JLB.MR0718-300R

4. Uniprot (P26715)

5. Borst, L., van der Burg, S. H., & van Hall, T. (2020). The NKG2A-HLA-E Axis as a Novel Checkpoint in the Tumor Microenvironment. Clinical cancer research : an official journal of the American Association for Cancer Research, 26(21), 5549-5556. https://doi.org/10.1158/1078-0432.CCR-19-2095

6. Andre, P., Denis, C., Soulas, C., Bourbon-Caillet, C., Lopez, J., Arnoux, T., Blery, M., Bonnafous, C., Gauthier, L., Morel, A., Rossi, B., Remark, R., Breso, V., Bonnet, E., Habif, G., Guia, S., Lalanne, A. I., Hoffmann, C., Lantz, O., Fayette, J., ... Vivier, E. (2018). Anti-NKG2A mAb Is a Checkpoint Inhibitor that Promotes Anti-tumor Immunity by Unleashing Both T and NK Cells. Cell, 175(7), 1731-1743.e13. https://doi.org/10.1016/j.cell.2018.10.014

Long Name

Natural Killer G2A

Alternate Names

CD159a, Klrc1, NKG2

Gene Symbol

KLRC1

UniProt

P26715-2 (Human)

Additional NKG2A/CD159a Products

Product Documents for NKG2A/CD159a/KLRC1 Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for NKG2A/CD159a/KLRC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.