Osteocalcin Antibody (190125) [CoraFluor™ 1]

CoraFluor 1

Monoclonal Mouse IgG₁ Clone # 190125

Please see the vial label for concentration. If unlisted please contact technical services.

Human Osteocalcin synthetic peptide
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Accession # P02818

Detects human Osteocalcin in direct ELISAs.

Monoclonal

Mouse

IgG₁

CoraFluor(TM) 1 is a high performance terbium-based TR-FRET (Time-Resolved Fluorescence Resonance Energy Transfer) or TRF (Time-Resolved Fluorescence) donor for high throughput assay development. CoraFluor(IM) 1 absorbs UV light at approximately 340 nm, and emits at approximately 490 nm, 545 nm, 585 nm and 620 nm. It is compatible with common acceptor dyes that absorb at the emission wavelengths of CoraFluor(TM) 1. CoraFluor(TM) 1 can be used for the development of robust and scalable TR-FRET binding assays such as target engagement, ternary complex, protein-protein interaction and protein quantification assays.

Protein A or G purified

PBS

No Preservative

Please see the vial label for concentration. If unlisted please contact technical services.

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Store at 4C in the dark. Do not freeze.