Proteasome 20S beta2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-54590

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-54590
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all Proteasome 20S beta2 Antibodies »

Product Summary for Proteasome 20S beta2 Antibody

Immunogen

Synthetic peptides corresponding to PSMB2(proteasome (prosome, macropain) subunit, beta type, 2) The peptide sequence was selected from the middle region of PSMB2 (NP_002785). Peptide sequence LDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLD. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: beta type-2.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Proteasome 20S beta2 Antibody

Western Blot: Proteasome 20S beta2 Antibody [NBP1-54590]

Western Blot: Proteasome 20S beta2 Antibody [NBP1-54590]

Western Blot: Proteasome 20S beta2 Antibody [NBP1-54590] - Analysis of HepG2 cell lysate. Antibody Dilution: 1.0 ug/ml PSMB2 is supported by BioGPS gene expression data to be expressed in HepG2.
Western Blot: Proteasome 20S beta2 Antibody [NBP1-54590]

Western Blot: Proteasome 20S beta2 Antibody [NBP1-54590]

Western Blot: Proteasome 20S beta2 Antibody [NBP1-54590] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.
Western Blot: Proteasome 20S beta2 Antibody [NBP1-54590]

Western Blot: Proteasome 20S beta2 Antibody [NBP1-54590]

Western Blot: Proteasome 20S beta2 Antibody [NBP1-54590] - Jurkat, Antibody Dilution: 1.0 ug/ml PSMB2 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.
View 1 more images

Applications for Proteasome 20S beta2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Proteasome 20S beta2

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMB2 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Proteasome subunit beta type-2

Alternate Names

PSMB2

Entrez Gene IDs

5690 (Human)

Gene Symbol

PSMB2

UniProt

P49721 (Human)

Additional Proteasome 20S beta2 Products

Product Documents for Proteasome 20S beta2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Proteasome 20S beta2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.