RFC5 Antibody [Janelia Fluor® 525]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-38501JF525

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Western Blot

Label

Janelia Fluor 525

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all RFC5 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 181-340 of human RFC5 (NP_031396.1).

Sequence:
LMVPRLEHVVEEEKVDISEDGMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTGHPLKSDIANILDWMLNQDFTTAYRNITELKTLKGLALHDILTEIHLFVHRVDFPSSVRIHLLTKMADIEYRLSVGTNEKIQLSSLIAAFQVTRDLIVAEA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Applications for RFC5 Antibody [Janelia Fluor® 525]

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: RFC5

The Replication factor C (RFC) heteropentamer includes RFC1, RFC2, RFC3, RFC4, and RFC5. The RFC heteropentamer is part of the multiprotein DNA replicase that functions to replicate DNA prior to cell division and repair DNA damage. RFC is the clamp loader ATPase associated with the DNA replicase. As the clamp loader, RFC uses ATP to recruit, open, and close the PCNA ring to link it to DNA for replication and repair. RFC5 is the 36kDa subunit of RFC that forms a core complex with RFC2 and RFC4 and can interact with the C-terminal region of PCNA. RFC5 is also known as replication factor C 36 kDa subunit RF-C 36 kDa subunit, RFC36, Activator 1 36 kDa subunit, A1 36 kDa subunit, and MGC1155.

Alternate Names

Activator 1 36 kDa subunit, Activator 1 subunit 5,36.5 kD subunit, MGC1155, replication factor C (activator 1) 5, 36.5kDa, RF-C 36 kDa subunit, RFC36replication factor C (activator 1) 5 (36.5kD)

Gene Symbol

RFC5

Additional RFC5 Products

Product Documents for RFC5 Antibody [Janelia Fluor® 525]

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for RFC5 Antibody [Janelia Fluor® 525]



Sold under license from the Howard Hughes Medical Institute, Janelia Research Campus.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.