RFX2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-13224

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-13224
NBP2-13224-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all RFX2 Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: VMGEFNDLASLSLTLLDKDDMGDEQRGSEAGPDARSLGEPLVKRERSDPNHSLQGI

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (80%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RFX2 Antibody

Immunohistochemistry-Paraffin: RFX2 Antibody [NBP2-13224]

Immunohistochemistry-Paraffin: RFX2 Antibody [NBP2-13224]

Immunohistochemistry-Paraffin: RFX2 Antibody [NBP2-13224] - Analysis in human testis and liver tissues. Corresponding RFX2 RNA-seq data are presented for the same tissues.
Western Blot: RFX2 Antibody [NBP2-13224]

Western Blot: RFX2 Antibody [NBP2-13224]

Western Blot: RFX2 Antibody [NBP2-13224] - Analysis in human cell line SCLC-21H.
Immunocytochemistry/ Immunofluorescence: RFX2 Antibody [NBP2-13224]

Immunocytochemistry/ Immunofluorescence: RFX2 Antibody [NBP2-13224]

Immunocytochemistry/Immunofluorescence: RFX2 Antibody [NBP2-13224] - Staining of human cell line MCF7 shows localization to nucleoplasm, cytosol & the Golgi apparatus. Antibody staining is shown in green.
View 4 more images

Applications for RFX2 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RFX2

RFX2 is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. The protein encoded by this gene is structurally related to regulatory factors X1, X3, X4, and X5. It is a transcriptional activator that can bind DNA as a monomer or as a heterodimer with other RFX family members. This protein can bind to cis elements in the promoter of the IL-5 receptor alpha gene. Two transcript variants encoding different isoforms have been described for this gene, and both variants utilize alternative polyadenylation sites. [provided by RefSeq]

Alternate Names

DNA binding protein RFX2, DNA-binding protein RFX2, FLJ14226, HLA class II regulatory factor RFX2, Regulatory factor X 2, regulatory factor X, 2 (influences HLA class II expression), trans-acting regulatory factor 2

Gene Symbol

RFX2

Additional RFX2 Products

Product Documents for RFX2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for RFX2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.