S100A1 Antibody (1D5)

Novus Biologicals, part of Bio-Techne | Catalog # H00006271-M01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
H00006271-M01
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Sandwich ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 1D5

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all S100A1 Antibodies »

Product Specifications

Immunogen

S100A1 (NP_006262, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEY

Localization

Cytoplasmic and Nuclear

Specificity

S100A1 - S100 calcium binding protein A1

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for S100A1 Antibody (1D5)

Western Blot: S100A1 Antibody (1D5) [H00006271-M01]

Western Blot: S100A1 Antibody (1D5) [H00006271-M01]

Western Blot: S100A1 Antibody (1D5) [H00006271-M01] - Analysis of S100A1 expression in transfected 293T cell line by S100A1 monoclonal antibody (M01), clone 1D5.Lane 1: S100A1 transfected lysate(10.5 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: S100A1 Antibody (1D5) [H00006271-M01] - Detection limit for recombinant GST tagged S100A1 is approximately 0.3ng/ml as a capture antibody.

Applications for S100A1 Antibody (1D5)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: S100A1

S100 belongs to the family of calcium binding proteins such as calmodulin and troponin C. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. S100A is composed of an alpha and beta chain whereas S100B is composed of two beta chains. S100 protein may function in stimulation of Ca2+ induced Ca2+ release, inhibition of microtubule assembly, and inhibition of protein kinase C mediated phosphorylation. Reduced expression of this protein has been implicated in cardiomyopathies. Immunoreactive S100 protein localizes in the cytoplasm and nuclei of astrocytes, Schwann's cells, ependymomas and astrogliomas. Ganglion cells do not stain for S100 protein. S100 can be detected in almost all benign naevi and malignant melanocytic tumors of the skin, and in Langerhans cells in the skin.

Long Name

S100 Calcium Binding Protein A1

Alternate Names

protein S100-A1, S100 alpha, S100 calcium binding protein A1, S100 calcium-binding protein A1S100, S-100 protein alpha chain, S-100 protein subunit alpha, S100 protein, alpha polypeptide, S100A, S100-alpha

Entrez Gene IDs

6271 (Human)

Gene Symbol

S100A1

OMIM

176940 (Human)

UniProt

P23297

Additional S100A1 Products

Product Documents for S100A1 Antibody (1D5)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for S100A1 Antibody (1D5)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.