Septin-7 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-85730

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-85730
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Septin-7 Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MSVSARSAAAEERSVNSSTMVAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Septin-7 Antibody

Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730]

Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730]

Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730] - Staining in human cerebral cortex and skeletal muscle tissues . Corresponding SEPT7 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730]

Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730]

Immunohistochemistry-Paraffin: Septin-7 Antibody [NBP1-85730] - Staining of human cerebral cortex, lymph node, skeletal muscle and testis using Anti-SEPT7 antibody NBP1-85730 (A) shows similar protein distribution across tissues to independent antibody NBP1-85731 (B).
Western Blot: Septin-7 Antibody [NBP1-85730]

Western Blot: Septin-7 Antibody [NBP1-85730]

Western Blot: Septin-7 Antibody [NBP1-85730] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
View 6 more images

Applications for Septin-7 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Septin-7

This gene encodes a protein that is highly similar to the CDC10 protein of Saccharomyces cerevisiae. The protein also shares similarity with Diff 6 of Drosophila and with H5 of mouse. Each of these similar proteins, including the yeast CDC10, contains a GTP-binding motif. The yeast CDC10 protein is a structural component of the 10 nm filament which lies inside the cytoplasmic membrane and is essential for cytokinesis. Although the exact function of this gene has not yet been determined, its high similarity to yeast CDC10 and the high conservative nature of eukaryotic cell cycle machinery suggest a similar role to that of its yeast counterpart. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq]

Alternate Names

CDC10 cell division cycle 10 homolog, CDC10 cell division cycle 10 homolog (S. cerevisiae), CDC10 protein homolog, CDC10S. cerevisiae, homolog), Nbla02942, septin 7, septin-7

Entrez Gene IDs

989 (Human)

Gene Symbol

SEPTIN7

UniProt

Q16181 (Human)

Additional Septin-7 Products

Product Documents for Septin-7 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Septin-7 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.