Skp2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56192

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-56192
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence, Knockdown Validated, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Skp2 Antibodies »

Product Summary for Skp2 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL

Reactivity Notes

Mouse 88%, Rat 88%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Skp2 Antibody

Western Blot: Skp2 Antibody [NBP2-56192]

Western Blot: Skp2 Antibody [NBP2-56192]

Western Blot: Skp2 Antibody [NBP2-56192] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: Skp2 Antibody [NBP2-56192]

Immunocytochemistry/ Immunofluorescence: Skp2 Antibody [NBP2-56192]

Immunocytochemistry/Immunofluorescence: Skp2 Antibody [NBP2-56192] - Staining of human cell line PC-3 shows localization to nucleus, nucleoli & cytosol.
Western Blot: Skp2 Antibody [NBP2-56192]

Western Blot: Skp2 Antibody [NBP2-56192]

Western Blot: Skp2 Antibody [NBP2-56192] - Analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-SKP2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Applications for Skp2 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Skp2

The critical role that the family of regulatory proteins known as cyclins plays in eukaryotic cell cycle regulation is well established. The best characterized cyclin complex is the mitotic cyclin B/Cdc2 p34 kinase, the active component of MPF (maturation promoting factor). Cyclin A accumulates prior to cyclin B in the cell cycle, appears to be involved in control of S phase and has been shown to associate with cyclin dependent kinase 2 (Cdk2). In addition, cyclin A has been implicated in cell transformation and is found in complexes with E1A, transcription factors DP-1 and E2F, and retinoblastoma protein p110. Two cyclin A-Cdk2 complex binding proteins, Skp1 p19 and Skp2 p45, have been described. Although the Skps (S phase kinase-associated proteins) associate with the active cyclin A-Cdk2 complex, they do not exhibit any regulatory effects on the complex. Abolition of Skp2 p45 function by either microinjection of anti-p45 antibodies or addition of antisense oligonucleotides prevents entry into S phase of both normal and transformed cells.

Long Name

S Phase Kinase-associated Protein 2

Alternate Names

FBL1, FBXL1, p45skp2

Gene Symbol

SKP2

Additional Skp2 Products

Product Documents for Skp2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Skp2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.