SLC38A3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-60103

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-60103
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all SLC38A3 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC38A3(solute carrier family 38, member 3) The peptide sequence was selected from the N terminal of SLC38A3. Peptide sequence GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SLC38A3 Antibody

Western Blot: SLC38A3 Antibody [NBP1-60103]

Western Blot: SLC38A3 Antibody [NBP1-60103]

Western Blot: SLC38A3 Antibody [NBP1-60103] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: SLC38A3 Antibody [NBP1-60103]

Immunohistochemistry: SLC38A3 Antibody [NBP1-60103]

Immunohistochemistry: SLC38A3 Antibody [NBP1-60103] - Dilution : 1: 200 Secondary Antibody : Goat anti-rabbit Alexafluor 568 Secondary Antibody Dilution : 1: 200 Color/Signal Descriptions : SLC38A3: Red CtBp: Green DAPI: Blue Gene Name : SLC38A3 Submitted by : Anonymous
Immunohistochemistry: SLC38A3 Antibody [NBP1-60103]

Immunohistochemistry: SLC38A3 Antibody [NBP1-60103]

Immunohistochemistry: SLC38A3 Antibody [NBP1-60103] - :1:200 Secondary Antibody : Goat anti-rabbit Alexafluor 568 Secondary Antibody Dilution :1:200 Color/Signal Descriptions :SLC38A3: Red CtBp: Green DAPI: Blue. submitted by anonymous customer

Applications for SLC38A3 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC38A3

As a sodium-dependent amino acid/proton antiporter, SLC38A3 mediates electrogenic cotransport of glutamine and sodium ions in exchange for protons. It also recognizes histidine, asparagine and alanine. It may mediate amino acid transport in either direction under physiological conditions and play a role in nitrogen metabolism and synaptic transmission.

Alternate Names

G17sodium-coupled neutral amino acid transporter 3, Na(+)-coupled neutral amino acid transporter 3, NAT1, N-system amino acid transporter 1, SN1system N1 Na+ and H+-coupled glutamine transporter, SNAT3, Solute carrier family 38 member 3, solute carrier family 38, member 3, System N amino acid transporter 1

Gene Symbol

SLC38A3

UniProt

Q99624 (Human)

Additional SLC38A3 Products

Product Documents for SLC38A3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for SLC38A3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.