SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15668

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-15668-100ul
NBP3-15668-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5T7M2

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all SLC6A4/5-HTTLPR Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC6A4/5-HTTLPR/Serotonin transporter (NP_001036.1). METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2)

Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [NBP3-15668]

Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [NBP3-15668]

Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [NBP3-15668] - Western blot analysis of extracts of various cell lines, using SLC6A4/5-HTTLPR/Serotonin transporter antibody (NBP3-15668) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunocytochemistry/ Immunofluorescence: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [NBP3-15668]

Immunocytochemistry/ Immunofluorescence: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [NBP3-15668]

Immunocytochemistry/Immunofluorescence: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [NBP3-15668] - Immunofluorescence analysis of human liver cancer using SLC6A4/5-HTTLPR/Serotonin transporter Rabbit mAb (NBP3-15668) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [NBP3-15668]

Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [NBP3-15668]

Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [NBP3-15668] - Western blot analysis of extracts of various cell lines, using SLC6A4/5-HTTLPR/Serotonin transporter antibody (NBP3-15668) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Applications for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SLC6A4/5-HTTLPR

Serotonin transporter encodes an integral membrane protein that transports the neurotransmitter serotonin from synaptic spaces into presynaptic neurons. The encoded protein terminates the action of serotonin and recycles it in a sodium-dependent manner. This protein is a target of psychomotor stimulants, such as amphetamines and cocaine, and is a member of the sodium:neurotransmitter symporter family. A repeat length polymorphism in the promoter of this gene has been shown to affect the rate of serotonin uptake and may play a role in sudden infant death syndrome, aggressive behavior in Alzheimer disease patients, and depression-susceptibility in people experiencing emotional trauma.

Long Name

Solute Carrier Family 6 Member 4

Alternate Names

5-HT Transporter, 5-HTT, 5-HTTLPR, 5HTTLPR, OCD1, Serotonin Transporter 1, SERT

Gene Symbol

SLC6A4

Additional SLC6A4/5-HTTLPR Products

Product Documents for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.