Sodium Calcium Exchanger 1/NCX1 Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-94316

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-94316-0.02ml
NBP2-94316-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Sodium Calcium Exchanger 1/NCX1 Antibodies »

Product Summary for Sodium Calcium Exchanger 1/NCX1 Antibody - Azide and BSA Free

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 600-700 of human Sodium Calcium Exchanger 1/NCX1 (NP_066920.1). DEIVKTISVKVIDDEEYEKNKTFFLEIGEPRLVEMSEKKALLLNELGGFTITGKYLFGQPVFRKVHAREHPILSTVITIADEYDDKQPLTSKEEEERRIAE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Sodium Calcium Exchanger 1/NCX1 Antibody - Azide and BSA Free

Western Blot: Sodium Calcium Exchanger 1/NCX1 AntibodyAzide and BSA Free [NBP2-94316]

Western Blot: Sodium Calcium Exchanger 1/NCX1 AntibodyAzide and BSA Free [NBP2-94316]

Western Blot: Sodium Calcium Exchanger 1/NCX1 Antibody [NBP2-94316] - Analysis of extracts of various cell lines, using Sodium Calcium Exchanger 1/NCX1 antibody (NBP2-94316) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunohistochemistry-Paraffin: Sodium Calcium Exchanger 1/NCX1 Antibody - Azide and BSA Free [NBP2-94316]

Immunohistochemistry-Paraffin: Sodium Calcium Exchanger 1/NCX1 Antibody - Azide and BSA Free [NBP2-94316]

Immunohistochemistry-Paraffin: Sodium Calcium Exchanger 1/NCX1 Antibody [NBP2-94316] - Rat stomach using Sodium Calcium Exchanger 1/NCX1 Rabbit pAb (NBP2-94316) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Western Blot: Sodium Calcium Exchanger 1/NCX1 AntibodyAzide and BSA Free [NBP2-94316]

Western Blot: Sodium Calcium Exchanger 1/NCX1 AntibodyAzide and BSA Free [NBP2-94316]

Western Blot: Sodium Calcium Exchanger 1/NCX1 Antibody [NBP2-94316] - Analysis of extracts of Mouse brain , using Sodium Calcium Exchanger 1/NCX1 antibody (NBP2-94316) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
View 2 more images

Applications for Sodium Calcium Exchanger 1/NCX1 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:2000 - 1:6000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Sodium Calcium Exchanger 1/NCX1

NCX1 (Na(+)/Ca(2+) exchanger (NCX-1)) expression and protein levels vary during heart development and in response to changes in thyroid hormone levels (1). The expression of the NCX1 gene is two-fold higher in the hearts of fetal versus adult mice. In addition, NCX1 mRNA and protein levels were upregulated in hypothyroidic hearts. In hyperthyroidic hearts this response was reversed, however.

Alternate Names

NCX1, Slc8a1

Gene Symbol

SLC8A1

Additional Sodium Calcium Exchanger 1/NCX1 Products

Product Documents for Sodium Calcium Exchanger 1/NCX1 Antibody - Azide and BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Sodium Calcium Exchanger 1/NCX1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.