Sodium Potassium ATPase Alpha 1 Antibody (3L6F0)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15427

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-15427-100ul
NBP3-15427-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3L6F0

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Sodium Potassium ATPase Alpha 1 Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Sodium Potassium ATPase Alpha 1 (P05023). MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGF

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

113 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Sodium Potassium ATPase Alpha 1 Antibody (3L6F0)

Immunocytochemistry/ Immunofluorescence: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427]

Immunocytochemistry/ Immunofluorescence: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427]

Immunocytochemistry/Immunofluorescence: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Immunofluorescence analysis of NIH-3T3 cells using Sodium Potassium ATPase Alpha 1 Rabbit mAb (NBP3-15427) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427]

Immunocytochemistry/ Immunofluorescence: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427]

Immunocytochemistry/Immunofluorescence: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Immunofluorescence analysis of C6 cells using Sodium Potassium ATPase Alpha 1 Rabbit mAb (NBP3-15427) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Sodium Potassium ATPase Alpha 1 Antibody (3L6F0)

Western Blot: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] -

Western Blot: Sodium Potassium ATPase Alpha 1 Antibody (3L6F0) [NBP3-15427] - Analysis of extracts from HeLa cells, using Na+/K+-ATPase Rabbit mAb at 1:50000 dilution.Membrane protein extract isolated from Hela cells. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
View 4 more images

Applications for Sodium Potassium ATPase Alpha 1 Antibody (3L6F0)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:100 - 1:500

Immunohistochemistry-Paraffin

1:100 - 1:500

Western Blot

1:10000 - 1:120000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Sodium Potassium ATPase Alpha 1

Sodium Potassium ATPase is an integral membrane protein complex that hydrolyzes ATP to maintain the transmembrane gradients of Na+ and K+ found in most mammalian cells. The Sodium Potassium ATPase enzyme is comprised of an alpha and beta subunit. The alpha-polypeptide (Sodium Potassium ATPase Alpha 1) has been shown to be the catalytically active subunit, whereas the Beta-polypeptide appears to be necessary for the assembly and transport of the sodium pump to the plasma membrane. Sodium Potassium ATPase alpha-1 subunit, in the brain, is expressed in both neuronal and non-neuronal cells.

Long Name

Sodium/potassium-transporting ATPase subunit alpha-1

Alternate Names

ATP1A1, EC 7.2.2.13

Gene Symbol

ATP1A1

Additional Sodium Potassium ATPase Alpha 1 Products

Product Documents for Sodium Potassium ATPase Alpha 1 Antibody (3L6F0)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Sodium Potassium ATPase Alpha 1 Antibody (3L6F0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.