solute carrier family 22, member 18 antisense Antibody - BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-39093
![Immunohistochemistry-Paraffin: solute carrier family 22, member 18 antisense Antibody [NBP2-39093]](https://resources.bio-techne.com/images/products/solute-carrier-family-22--member-18-antisense-Antibody-Immunohistochemistry-Paraffin-NBP2-39093-img0006.jpg "Immunohistochemistry-Paraffin: solute carrier family 22, member 18 antisense Antibody [NBP2-39093]")
![Immunohistochemistry-Paraffin: solute carrier family 22, member 18 antisense Antibody [NBP2-39093]](https://resources.bio-techne.com/images/products/solute-carrier-family-22--member-18-antisense-Antibody-Immunohistochemistry-Paraffin-NBP2-39093-img0007.jpg "Immunohistochemistry-Paraffin: solute carrier family 22, member 18 antisense Antibody [NBP2-39093]")
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Human
Applications
Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ELPGSEGMWENCPLGWVKKKASGTLAPLDFLLQRKRLWLWASEPVRPQPQGIHRFREARRQFCRMRGSRLTGGRKG
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for solute carrier family 22, member 18 antisense Antibody - BSA Free
![Western Blot: solute carrier family 22, member 18 antisense Antibody [NBP2-39093]](https://resources.bio-techne.com/images/products/solute-carrier-family-22--member-18-antisense-Antibody-Western-Blot-NBP2-39093-img0002.jpg "Western Blot: solute carrier family 22, member 18 antisense Antibody [NBP2-39093]")
Western Blot: solute carrier family 22, member 18 antisense Antibody [NBP2-39093]
Western Blot: solute carrier family 22, member 18 antisense Antibody [NBP2-39093] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG![Immunocytochemistry/ Immunofluorescence: solute carrier family 22, member 18 antisense Antibody [NBP2-39093]](https://resources.bio-techne.com/images/products/solute-carrier-family-22--member-18-antisense-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-39093-img0004.jpg "Immunocytochemistry/ Immunofluorescence: solute carrier family 22, member 18 antisense Antibody [NBP2-39093]")
Immunocytochemistry/ Immunofluorescence: solute carrier family 22, member 18 antisense Antibody [NBP2-39093]
Immunocytochemistry/Immunofluorescence: solute carrier family 22, member 18 antisense Antibody [NBP2-39093] - Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleoplasm.![Immunohistochemistry-Paraffin: solute carrier family 22, member 18 antisense Antibody [NBP2-39093]](https://resources.bio-techne.com/images/products/solute-carrier-family-22--member-18-antisense-Antibody-Immunohistochemistry-Paraffin-NBP2-39093-img0008.jpg "Immunohistochemistry-Paraffin: solute carrier family 22, member 18 antisense Antibody [NBP2-39093]")
Immunohistochemistry-Paraffin: solute carrier family 22, member 18 antisense Antibody [NBP2-39093]
Immunohistochemistry-Paraffin: solute carrier family 22, member 18 antisense Antibody [NBP2-39093] - Staining in human duodenum and liver tissues using anti-SLC22A18AS antibody. Corresponding SLC22A18AS RNA-seq data are presented for the same tissues.Applications for solute carrier family 22, member 18 antisense Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Immunogen affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: solute carrier family 22, member 18 antisense
Alternate Names
BWR1BSolute carrier family 22 member 18 antisense protein, BWSCR1BBeckwith-Wiedemann region 1B, ORCTL2Sbeckwith-Wiedemann syndrome chromosomal region 1 candidate gene B protein, organic cation transporter-like 2 antisense, Organic cation transporter-like protein 2 antisense protein, p27-BWR1Bp27-Beckwith-Wiedemann region 1 B, SLC22A1LSBeckwith-Wiedemann syndrome chromosome region 1, candidate b, solute carrier family 22 (organic cation transporter), member 18 antisense, solute carrier family 22 (organic cation transporter), member 1-like antisense, Solute carrier family 22 member 1-like antisense protein
Gene Symbol
SLC22A18AS
UniProt
Additional solute carrier family 22, member 18 antisense Products
Product Documents for solute carrier family 22, member 18 antisense Antibody - BSA Free
Product Specific Notices for solute carrier family 22, member 18 antisense Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...