TEAD4 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-82386

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-82386
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all TEAD4 Antibodies »

Product Specifications

Immunogen

Synthetic peptide towards Tead4. Peptide sequence RRKAREIQAKLKDQAAKNKALQSMAAMSSAQIVSATAFHSKMALARGPGY. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TEAD4 Antibody

Western Blot: TEAD4 Antibody [NBP1-82386]

Western Blot: TEAD4 Antibody [NBP1-82386]

Western Blot: TEAD4 Antibody [NBP1-82386] - Antibody Titration: 1 ug/ml Human liver.
Western Blot: TEAD4 Antibody [NBP1-82386]

Western Blot: TEAD4 Antibody [NBP1-82386]

Western Blot: TEAD4 Antibody [NBP1-82386] - Mouse Intestine Lysate 1.0 ug/ml, gel comcentration 12%
Western Blot: TEAD4 Antibody [NBP1-82386]

Western Blot: TEAD4 Antibody [NBP1-82386]

Western Blot: TEAD4 Antibody [NBP1-82386] - Antibody Titration: 1 ug/ml Human heart.

Applications for TEAD4 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TEAD4

TEAD4 product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene.

Alternate Names

EFTR-2, hRTEF-1B, related transcription enhancer factor 1B, RTEF1RTEF-1, TCF13L1MGC9014, TEA domain family member 4TEF3, TEAD-4, TEF-3, TEFR-1, Transcription factor 13-like 1, Transcription factor RTEF-1, transcriptional enhancer factor 1-related, transcriptional enhancer factor 3, transcriptional enhancer factor TEF-3

Gene Symbol

TEAD4

UniProt

NP_035697 (Mouse)

Additional TEAD4 Products

Product Documents for TEAD4 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for TEAD4 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.