Topoisomerase I Antibody (3D4W6)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15450

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-15450-20ul
NBP3-15450-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunoprecipitation, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3D4W6

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Topoisomerase I Antibodies »

Product Summary for Topoisomerase I Antibody (3D4W6)

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Topoisomerase I (P11387). MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

91 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Topoisomerase I Antibody (3D4W6)

Western Blot: Topoisomerase I Antibody (3D4W6) [NBP3-15450]

Western Blot: Topoisomerase I Antibody (3D4W6) [NBP3-15450]

Western Blot: Topoisomerase I Antibody (3D4W6) [NBP3-15450] - Western blot analysis of extracts of Mouse thymus, using DNA topoisomerase I (Topoisomerase I) Rabbit mAb (NBP3-15450) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody (3D4W6) [NBP3-15450]

Immunohistochemistry-Paraffin: Topoisomerase I Antibody (3D4W6) [NBP3-15450]

Immunohistochemistry-Paraffin: Topoisomerase I Antibody (3D4W6) [NBP3-15450] - Human thyroid cancer using DNA topoisomerase I (Topoisomerase I) Rabbit mAb (NBP3-15450) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunoprecipitation: Topoisomerase I Antibody (3D4W6) [NBP3-15450]

Immunoprecipitation: Topoisomerase I Antibody (3D4W6) [NBP3-15450]

Immunoprecipitation: Topoisomerase I Antibody (3D4W6) [NBP3-15450] - Immunoprecipitation analysis of 300ug extracts of MCF7 cells using 3ug Topoisomerase I antibody (NBP3-15450). Western blot was performed from the immunoprecipitate using Topoisomerase I antibody (NBP3-15450) at a dilition of 1:1000.
View 2 more images

Applications for Topoisomerase I Antibody (3D4W6)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:200 - 1:1000

Immunohistochemistry

1:200 - 1:800

Immunohistochemistry-Paraffin

1:200 - 1:800

Immunoprecipitation

0.5μg-4μg antibody for 200μg-400μg extracts of whole cells

Western Blot

1:1000 - 1:6000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Topoisomerase I

Topoisomerases are nuclear enzymes involved in a variety of cellular activities such as chromosome condensation, DNA replication, transcription, recombination and segregation at mitosis. Human topoisomerase I is a 100kD protein capable of relaxing positively and negatively supercoiled DNA by performing a transient single stranded nick which is then religated at the end of the reaction. It has been shown that the enzyme is located in regions of the genome that are undergoing active RNA synthesis, where it probably reduces superhelical stresses in the DNA, enabling RNA polymerase to function properly. Both DNA topoisomerases I and II have been found to be targets of autoantibodies in the sera of patients with certain autoimmune diseases such as systemic lupus erythematosus and also of some anti tumor drugs and antibiotics. Elevated levels of DNA topoisomerase I, detected by transfer assays, have been demonstrated in colorectal tumors compared with normal colon mucosa as a result of increased transcription or mRNA stability.

Long Name

DNA topoisomerase 1

Alternate Names

DNA topoisomerase I, EC 5.6.2.1, TOP1

Gene Symbol

TOP1

Additional Topoisomerase I Products

Product Documents for Topoisomerase I Antibody (3D4W6)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Topoisomerase I Antibody (3D4W6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.