Transaldolase 1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-88109

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-88109
NBP1-88109-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Transaldolase 1 Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MSSSPVKRQRMESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGRKLGGS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Transaldolase 1 Antibody

Western Blot: Transaldolase 1 Antibody [NBP1-88109]

Western Blot: Transaldolase 1 Antibody [NBP1-88109]

Western Blot: Transaldolase 1 Antibody [NBP1-88109] - Analysis in human cell line HepG2.
Immunocytochemistry/ Immunofluorescence: Transaldolase 1 Antibody [NBP1-88109]

Immunocytochemistry/ Immunofluorescence: Transaldolase 1 Antibody [NBP1-88109]

Immunocytochemistry/Immunofluorescence: Transaldolase 1 Antibody [NBP1-88109] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Western Blot: Transaldolase 1 Antibody [NBP1-88109]

Western Blot: Transaldolase 1 Antibody [NBP1-88109]

Western Blot: Transaldolase 1 Antibody [NBP1-88109] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
View 1 more images

Applications for Transaldolase 1 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Transaldolase 1

Transaldolase 1 is a key enzyme of the nonoxidative pentose phosphate pathway providing ribose-5-phosphate for nucleic acid synthesis and NADPH for lipid biosynthesis. This pathway can also maintain glutathione at a reduced state and thus protect sulfhydryl groups and cellular integrity from oxygen radicals. The functional gene of transaldolase 1 is located on chromosome 11 and a pseudogene is identified on chromosome 1 but there are conflicting map locations. The second and third exon of this gene were developed by insertion of a retrotransposable element. This gene is thought to be involved in multiple sclerosis. [provided by RefSeq]

Alternate Names

dihydroxyacetone transferase, EC 2.2.1.2, glycerone transferase, TAL, TALDO, TALDOR, TALH, TAL-H, transaldolase, transaldolase 1

Gene Symbol

TALDO1

Additional Transaldolase 1 Products

Product Documents for Transaldolase 1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Transaldolase 1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.