TRIM13 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-88466

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-88466
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

0.5 mg/ml

View all TRIM13 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRIM13. Peptide sequence: DTLETSKRKSLQLLTKDSDKVKEFFEKLQHTLDQKKNEILSDFETMKLAV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TRIM13 Antibody - BSA Free

Western Blot: TRIM13 Antibody [NBP2-88466]

Western Blot: TRIM13 Antibody [NBP2-88466]

Western Blot: TRIM13 Antibody [NBP2-88466] - WB Suggested Anti-RFP2 Antibody Titration: 0.125ug/ml. ELISA Titer: 1:62500. Positive Control: Human Lung
Immunohistochemistry-Paraffin: TRIM13 Antibody [NBP2-88466]

Immunohistochemistry-Paraffin: TRIM13 Antibody [NBP2-88466]

Immunohistochemistry-Paraffin: TRIM13 Antibody [NBP2-88466] - Paraffin Embedded Tissue: Human alveolar cell. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml.
Western Blot: TRIM13 Antibody [NBP2-88466]

Western Blot: TRIM13 Antibody [NBP2-88466]

Western Blot: TRIM13 Antibody [NBP2-88466] - Host: Rabbit. Target Name: TRIM13. Sample Tissue: Human DLD1 Whole Cell. Antibody Dilution: 1ug/ml
View 2 more images

Applications for TRIM13 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRIM13

Ret finger protein 2 This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This gene is located on chromosome 6. Multiple alternatively spliced transcript variants have been found for this gene. Mouse polyclonal antibody raised against a partial recombinant RFP2.

Alternate Names

B-cell chronic lymphocytic leukemia tumor suppressor Leu5, CLL-associated RING finger, E3 ubiquitin-protein ligase TRIM13, EC 6.3.2.-, LEU5CAR, Leukemia-associated protein 5, Putative tumor suppressor RFP2, Ret finger protein 2RING finger protein 77, RFP2DLEU5, RNF77Leu5, tripartite motif containing 13, tripartite motif protein 13, tripartite motif-containing 13, Tripartite motif-containing protein 13

Gene Symbol

TRIM13

Additional TRIM13 Products

Product Documents for TRIM13 Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TRIM13 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.