Tropomyosin-1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-52887

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-52887
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all Tropomyosin-1 Antibodies »

Product Summary for Tropomyosin-1 Antibody

Immunogen

Synthetic peptides corresponding to TPM1(tropomyosin 1 (alpha)) The peptide sequence was selected from the middle region of TPM1. Peptide sequence LKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Tropomyosin-1 Antibody

Western Blot: Tropomyosin-1 Antibody [NBP1-52887]

Western Blot: Tropomyosin-1 Antibody [NBP1-52887]

Western Blot: Tropomyosin-1 Antibody [NBP1-52887] - Human Brain lysate, concentration 0.2-1 ug/ml.

Applications for Tropomyosin-1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Tropomyosin-1

TPM1 is a member of the tropomyosin family of highly conserved, widely distributed actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is composed of two alpha-helical chains arranged as a coiled-coil. It is polymerized end to end along the two grooves of actin filaments and provides stability to the filaments. The protein is one type of alpha helical chain that forms the predominant tropomyosin of striated muscle, where it also functions in association with the troponin complex to regulate the calcium-dependent interaction of actin and myosin during muscle contraction. This gene is a member of the tropomyosin family of highly conserved, widely distributed actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is composed of two alpha-helical chains arranged as a coiled-coil. It is polymerized end to end along the two grooves of actin filaments and provides stability to the filaments. The encoded protein is one type of alpha helical chain that forms the predominant tropomyosin of striated muscle, where it also functions in association with the troponin complex to regulate the calcium-dependent interaction of actin and myosin during muscle contraction. In smooth muscle and non-muscle cells, alternatively spliced transcript variants encoding a range of isoforms have been described. Mutations in this gene are associated with type 3 familial hypertrophic cardiomyopathy.

Alternate Names

alpha tropomyosin, alpha-tropomyosin, C15orf13, cardiomyopathy, hypertrophic 3, chromosome 15 open reading frame 13, CMD1Y, CMH3, HTM-alpha, sarcomeric tropomyosin kappa, TMSA, tropomyosin 1 (alpha), tropomyosin 1 (alpha) isoform 1, tropomyosin 1 (alpha) isoform 2, tropomyosin 1 (alpha) isoform 3, tropomyosin 1 (alpha) isoform 4, tropomyosin 1 (alpha) isoform 5, tropomyosin 1 (alpha) isoform 6, tropomyosin 1 (alpha) isoform 7, tropomyosin alpha-1 chain, tropomyosin-1

Gene Symbol

TPM1

UniProt

Q7Z6L8 (Human)

Additional Tropomyosin-1 Products

Product Documents for Tropomyosin-1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Tropomyosin-1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.