TSPAN8/TM4SF3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-62380

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-62380
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all TSPAN8 Antibodies »

Product Summary for TSPAN8/TM4SF3 Antibody

Immunogen

Synthetic peptides corresponding to TSPAN8(tetraspanin 8) The peptide sequence was selected from the middle region of TSPAN8. Peptide sequence VFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TSPAN8/TM4SF3 Antibody

Western Blot: TSPAN8/TM4SF3 Antibody [NBP1-62380]

Western Blot: TSPAN8/TM4SF3 Antibody [NBP1-62380]

Western Blot: TM4SF3 Antibody [NBP1-62380] - Human Brain lysate, concentration 0.2-1 ug/ml.
Western Blot: TSPAN8/TM4SF3 Antibody [NBP1-62380]

Western Blot: TSPAN8/TM4SF3 Antibody [NBP1-62380]

Western Blot: TM4SF3 Antibody [NBP1-62380] - Expressed in E. coli, concentration 1 ug/ml.

Applications for TSPAN8/TM4SF3 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TSPAN8

TSPAN8 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. TSPAN8 is a cell surface glycoprotein that is known to complex with integrins. TSPAN8 is expressed in different carcinomas.The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This gene is expressed in different carcinomas. The use of alternate polyadenylation sites has been found for this gene.

Long Name

Tetraspanin 8/Transmembrane 4 Superfamily, Member 3

Alternate Names

CO-029, TM4SF3

Gene Symbol

TSPAN8

UniProt

P19075 (Human)

Additional TSPAN8 Products

Product Documents for TSPAN8/TM4SF3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for TSPAN8/TM4SF3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.