Tyrosinase Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16989

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16989-100ul
NBP3-16989-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Tyrosinase Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FPRACVSSKNLMEKECCPPWSGDRSPCGQLSGRGSCQNILLSNAPLGPQFPFTGVDDRESW

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Tyrosinase Antibody

Immunocytochemistry/ Immunofluorescence: Tyrosinase Antibody [NBP3-16989]

Immunocytochemistry/ Immunofluorescence: Tyrosinase Antibody [NBP3-16989]

Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody [NBP3-16989] - Analysis in human skin and skeletal muscle tissues using Anti-TYR antibody. Corresponding TYR RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Tyrosinase Antibody [NBP3-16989]

Immunohistochemistry-Paraffin: Tyrosinase Antibody [NBP3-16989]

Immunohistochemistry-Paraffin: Tyrosinase Antibody [NBP3-16989] - Staining of human skin shows high expression.
Immunohistochemistry-Paraffin: Tyrosinase Antibody [NBP3-16989]

Immunohistochemistry-Paraffin: Tyrosinase Antibody [NBP3-16989]

Immunohistochemistry-Paraffin: Tyrosinase Antibody [NBP3-16989] - Staining of human hair shows strong cytoplasmic positivity in medulla.
View 1 more images

Applications for Tyrosinase Antibody

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, pH 7.2, 40% glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Tyrosinase

Tyrosinase is a rate-limiting enzyme in the melanin biosynthetic pathway and a complete defect of the enzyme activity caused by homozygous mutations of the tyrosinase gene is well known to result in tyrosinase-negative oculocutaneous albinism (OCA1A) patients who never develop any melanin pigment in the skin, hair and eyes throughout life (1). Tyrosinase catalyzes the first two steps of melanin biosynthesis. Mutations of the TYR gene have been identified in a large number of patients, most of Caucasian ethnic origin, with various forms of type I OCA (2). Type I OCA results from mutations of the gene encoding tyrosinase, the enzyme that catalyzes the first 2 steps of melanin pigment biosynthesis. In type IA (tyrosinase-negative) OCA tyrosinase enzymatic activity is completely absent, and in type IB ("yellow") OCA tyrosinase activity is greatly reduced. More than 80% of the known missense substitutions associated with type I OCA cluster within 2 relatively small regions of the tyrosinase polypeptide, suggesting that these may correspond to functionally important sites within the enzyme (3).

Alternate Names

CMM8, EC 1.14.18.1, LB24-AB, Monophenol monooxygenase, OCA1A, OCAIA, SHEP3, SK29-AB, Tumor rejection antigen AB, tyrosinase, tyrosinase (oculocutaneous albinism IA)

Gene Symbol

TYR

Additional Tyrosinase Products

Product Documents for Tyrosinase Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Tyrosinase Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.