USH1C Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89190

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-89190
NBP1-89190-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human, Mouse

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all USH1C Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: IVEEEEKFKKQWEEDWGSKEQLLLPKTITAEVHPVPLRKPKYDQGVEPELEPADDLDGGTEEQGEQDFRKYEEGFDPYSM

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (85%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for USH1C Antibody

Western Blot: USH1C Antibody [NBP1-89190]

Western Blot: USH1C Antibody [NBP1-89190]

Western Blot: USH1C Antibody [NBP1-89190] - Analysis in human cell lines Caco-2 and PC-3 using anti-USH1C antibody. Corresponding USH1C RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.
Immunocytochemistry/ Immunofluorescence: USH1C Antibody [NBP1-89190]

Immunocytochemistry/ Immunofluorescence: USH1C Antibody [NBP1-89190]

Immunocytochemistry/Immunofluorescence: USH1C Antibody [NBP1-89190] - Staining of human cell line CACO-2 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: USH1C Antibody [NBP1-89190]

Immunohistochemistry-Paraffin: USH1C Antibody [NBP1-89190]

Immunohistochemistry-Paraffin: USH1C Antibody [NBP1-89190] - Staining of human duodenum shows strong membranous and cytoplasmic positivity in glandular cells.
View 1 more images

Applications for USH1C Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: USH1C

USH1C may be involved in protein-protein interaction. Defects in USH1C are the cause of Usher syndrome type 1c. It is an autosomal recessive sensory defect involving congenital profound sensorineural deafness, vestibular dysfunction, and blindness due to progressive retinitis pigmentosa. Defects in USH1C are also the cause of nonsyndromic recessive deafness.

Alternate Names

AIE75, AIE-75, Antigen NY-CO-38/NY-CO-37, Autoimmune enteropathy-related antigen AIE-75, deafness, autosomal recessive 18, DFNB18, harmonin, NY-CO-37, NY-CO-38, PDZ-45, PDZ73, PDZ-73, PDZ-73/NY-CO-38, Protein PDZ-73, Renal carcinoma antigen NY-REN-3, ush1cpst, Usher syndrome 1C (autosomal recessive, severe), Usher syndrome type-1C protein

Gene Symbol

USH1C

Additional USH1C Products

Product Documents for USH1C Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for USH1C Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.