Skip to main content

WHSC1 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-38487

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human, Mouse

Applications

ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human WHSC1 (NP_579877.1).

Sequence:
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGEPGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLEQGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

152 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for WHSC1 Antibody - BSA Free

WHSC1 Antibody

Immunohistochemistry: WHSC1 Antibody [NBP3-38487] -

Immunohistochemistry: WHSC1 Antibody [NBP3-38487] - Immunohistochemistry analysis of paraffin-embedded Mouse lung using WHSC1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
WHSC1 Antibody

Immunohistochemistry: WHSC1 Antibody [NBP3-38487] -

Immunohistochemistry: WHSC1 Antibody [NBP3-38487] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using WHSC1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
WHSC1 Antibody

Western Blot: WHSC1 Antibody [NBP3-38487] -

Western Blot: WHSC1 Antibody [NBP3-38487] - Western blot analysis of various lysates using WHSC1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for WHSC1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: WHSC1

WHSC1 encodes a protein that contains four domains present in other developmental proteins: a PWWP domain, an HMG box, a SET domain, and a PHD-type zinc finger. It is expressed ubiquitously in early development. Wolf-Hirschhorn syndrome (WHS) is a malformation syndrome associated with a hemizygous deletion of the distal short arm of chromosome 4. This gene maps to the 165 kb WHS critical region and has also been involved in the chromosomal translocation t(4;14)(p16.3;q32.3) in multiple myelomas. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. Some transcript variants are nonsense-mediated mRNA (NMD) decay candidates, hence not represented as reference sequences. [provided by RefSeq]

Alternate Names

EC 2.1.1.43, FLJ23286, IL5 promoter REII region-binding protein, KIAA1090, MGC176638, MMSETNSD2Multiple myeloma SET domain-containing protein, multiple myeloma SET domain containing protein type III, nuclear receptor binding SET domain protein 2, Nuclear SET domain-containing protein 2, probable histone-lysine N-methyltransferase NSD2, Protein trithorax-5, REIIBP, trithorax/ash1-related protein 5, TRX5, WHS, Wolf-Hirschhorn syndrome candidate 1, Wolf-Hirschhorn syndrome candidate 1 protein

Gene Symbol

NSD2

Additional WHSC1 Products

Product Documents for WHSC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for WHSC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...