XAB1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38332

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-38332
NBP2-38332-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all XAB1 Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ALDAGTAKDSLSPVLHPSDLILTRGTLDEEDEEADSDTDDIDHRVTEESHEEPAFQNFMQESMAQYWKRNNK

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (83%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for XAB1 Antibody

Western Blot: XAB1 Antibody [NBP2-38332]

Western Blot: XAB1 Antibody [NBP2-38332]

Western Blot: XAB1 Antibody [NBP2-38332] - Analysis using Anti-GPN1 antibody NBP2-38332 (A) shows similar pattern to independent antibody NBP1-90072 (B).
Immunocytochemistry/ Immunofluorescence: XAB1 Antibody [NBP2-38332]

Immunocytochemistry/ Immunofluorescence: XAB1 Antibody [NBP2-38332]

Immunocytochemistry/Immunofluorescence: XAB1 Antibody [NBP2-38332] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry: XAB1 Antibody [NBP2-38332]

Immunohistochemistry: XAB1 Antibody [NBP2-38332]

Immunohistochemistry: XAB1 Antibody [NBP2-38332] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Applications for XAB1 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: XAB1

The DNA methylation system is composed of methyl-CpG-binding proteins, as well as of DNA cytosine methyl transferases. Five methyl-CpG binding proteins were isolated: MeCP2, MBD1, MBD2, MBD3 and MBD4. MBD2 consists of two isoforms, MBD2a and MBD2b, which are generated from a single gene. MBD2a is a component of MeCP1, a large corepressor complex that represses transcription from densely methylated genes. Components of MeCP1 include MBD2, Mi-2, MTA2, MBD3 and HDAC1/2. MIZF and MBDin were isolated as proteins interacting with MBD2. MBDin, in turn, is identical to XPA binding protein 1 (XAB1). At the N erminus, the protein contains the consensus sequence for a GTP binding site. At the C terminus, the protein is characterized by an acidic domain containing a cluster of acidic amino acid residues. The transcriptional repression by MBD2 at methylated promoters is relieved by MBdin. XAB1 is expressed ubiquitously, and may be involved in nuclear localization of XPA.

Alternate Names

ATP(GTP)-binding protein, ATPBD1A, GPN-loop GTPase 1, GTPase, MBD2-interacting protein, MBDin, MBDINXPA binding protein 1, XAB1FLJ51176, XPA-binding protein 1

Gene Symbol

GPN1

UniProt

Q9HCN4 (Human)

Additional XAB1 Products

Product Documents for XAB1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for XAB1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.