4-1BB Ligand/TNFSF9 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56103PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-56103PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all 4-1BB Ligand/TNFSF9 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human 4-1BB Ligand/TNFSF9.

Source: E. coli

Amino Acid Sequence: SGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56103.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-56103PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: 4-1BB Ligand/TNFSF9

CD137 exists on the cell surface as a monomer with a molecular mass of 30 kDa and as a dimer of 55 kDa. Human and mouse CD137 share 60% amino acid identity. CD137 (4-1BB), a member of the tumor necrosis factor receptor superfamily, is a type I transmembrane glycoprotein expressed on the cell surface of activated splenic T cells and thymocytes. The functions of CD137 in T lymphocytes include regulating activation, proliferation and apoptosis. CD137 and CD28 are costimulatory molecules of T cell activation. Costimulatory molecules are important in initiating anti-tumor immune responses. CD137 plays an important role in regulating T-cell-dependent immune responses. Expression of CD137 correlates negatively with lymphocyte proliferation and positively with the degree of activation-induced cell death caused by mitogen over stimulation. In monocytes, CD137 induces activation, promotes adherence and prolongs survival.

Alternate Names

41BB Ligand, CD137L, TNFSF9

Gene Symbol

TNFSF9

Additional 4-1BB Ligand/TNFSF9 Products

Product Documents for 4-1BB Ligand/TNFSF9 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for 4-1BB Ligand/TNFSF9 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.