ABCA1 Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-58550PEP
Key Product Details
Source
E. coli
Tag
N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
Conjugate
Unconjugated
Applications
Antibody Competition
Product Specifications
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ABCA1.
Source: E. coli
Amino Acid Sequence: TLPWVQGIICNANNPCFRYPTPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQGYQLHLTSLCNGSKSEEMIQLGDQEVSELC
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Antibody Competition (10 - 100 molar excess)
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58550.
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
For further blocking tide related information and a protocol, click here.
Protein / Peptide Type
Recombinant Protein Antigen
Formulation, Preparation and Storage
NBP2-58550PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: ABCA1
ABCA1 is comprised of 2,261 amino acids with a theoretical molecular weight of 254 kDa and human ABCA1 shares 97% amino acid identity with mouse ABCA1. The general structure of ABCA consists of two transmembrane domains (TMDs) and two nucleotide binding domains (NBDs). ABCA1 is a widely distributed cell-membrane protein with the highest expression found in macrophages. DHHC8 mediated palmitoylation of ABCA1 is essential for its localization to the plasma membrane and expression of mouse ABCA1 (not human) is induced by cAMP analogs (2). ABCA1 is phosphorylated at Ser1042 and Ser2054 by PKA, with Ser2054 being key for regulating phospholipid efflux. Mutations in ABCA1 have been linked to atherosclerosis and the progression of metabolic syndrome phenotypes: high density lipoprotein deficiency type 1 (HDLD1); also known as Tangier disease (TGD), and high density lipoprotein deficiency type 2 (HDLD2); also known as familial hypoalphalipoproteinemia (FHA) (3).
References
1.Oram JF, Lawn RM. (2001) ABCA1. The gatekeeper for eliminating excess tissue cholesterol. J Lipid Res. 42(8):1173-9. PMID: 11483617
2.Singaraja RR, Kang MH, Vaid K, Sanders SS, Vilas GL, Arstikaitis P, Coutinho J, Drisdel RC, El-Husseini Ael D, Green WN, Berthiaume L, Hayden MR. (2009) Palmitoylation of ATP-binding cassette transporter A1 is essential for its trafficking and function. Circ Res. 105(2):138-47. PMID: 19556522
3.Attie AD. (2007) ABCA1: at the nexus of cholesterol, HDL and atherosclerosis. Trends in Biochemical Sciences 32(4):172-9. PMID: 17324574
Long Name
ATP-binding Cassette, Sub-family A (ABC1), Member 1
Alternate Names
ABC1, CERP, HDLDT1, TGD
Gene Symbol
ABCA1
Additional ABCA1 Products
Product Documents for ABCA1 Recombinant Protein Antigen
Product Specific Notices for ABCA1 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...