Recombinant Human Adenine Nucleotide Translocase 1 GST (N-Term) Protein

Name: Recombinant Human Adenine Nucleotide Translocase 1 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00000291-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00000291-P01

Submit a review

Product Datasheet / COA / SDS

Discontinued Product

H00000291-P01 has been discontinued. View all Adenine Nucleotide Translocase 1 products.

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all Adenine Nucleotide Translocase 1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-298 of Human SLC25A4

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

59.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images

SDS-PAGE: Recombinant Human Adenine Nucleotide Translocase 1 GST (N-Term) Protein [H00000291-P01]

SDS-Page: Adenine Nucleotide Translocase 1 Recombinant Protein [H00000291-P01]

Formulation, Preparation and Storage

H00000291-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Adenine Nucleotide Translocase 1

Adenine Nucleotide Translocase 1 (ANT1) catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane. It is is a key component of the mitochondrial permeability transition pore (PT pore) complex and is also one of the most abundant proteins in the mitochondrion making up approximately 10% of all mitochondrial proteins. Originally described as an ADP/ATP exchange factor, ANT1 has also been shown to be required for bax mediated apoptosis. This is effected by binding of bax to residues 105-156 of ANT1, presumably resulting in maintaining the PT pore in an open conformation. Interaction with bax is not required for ANT1 pro-apoptotic activity as overexpression of the ANT1 protein also leads to the induction of apoptosis.

Alternate Names

AAC1, Adenine nucleotide translocator 1, ADP, ADP/ATP translocase 1, ANT 1, ANT1adenine nucleotide translocator 1 (skeletal muscle), ATP carrier protein 1, ATP carrier protein, heart/skeletal muscle, ATP carrier protein, heart/skeletal muscle isoform T1, heart/skeletal muscle ATP/ADP translocator, PEO2, PEO3, solute carrier family 25 (mitochondrial carrier; adenine nucleotidetranslocator), member 4, Solute carrier family 25 member 4, T1ANT

Gene Symbol

SLC25A4

Additional Adenine Nucleotide Translocase 1 Products

Product Documents

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews