Adiponectin/Acrp30 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38657PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-38657PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all Adiponectin/Acrp30 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADIPOQ.

Source: E. coli

Amino Acid Sequence: YMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38657.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-38657PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Adiponectin/Acrp30

Adipose cells produce and secrete numerous physiologically important proteins, such as Lipoprotein Lipase, Leptin, and Adipocyte Complement Related protein of 30 kDa, also known as Acrp30 or Adiponectin. Adiponectin is a circulating protein that is secreted exclusively by differentiated adipocytes. During adipocyte differentiation, Adiponectin mRNA is induced >100 fold. Adiponectin improves the ability of insulin to suppress glucose production, at sub physiological levels, thereby linking adipose tissue to whole body glucose regulation. Adiponectin function appears to be regulated by phosphatidylinositol 3 kinase (PI3K) since Adiponectin secretion is blocked by pharmacologic inhibitors of this kinase. Adiponectin mRNA is significantly reduced in adipose tissue of obese patients with Type 2 diabetes. The structural similarity of Adiponectin to TNF alpha suggests that Adiponectin may play a role in pathogenesis of insulin resistance in Type 2 diabetes. Adiponectin is implicated as a regulator of whole body energy homeostasis.

Alternate Names

Acrp30, AdipoQ, ApM1, GBP28

Gene Symbol

ADIPOQ

Additional Adiponectin/Acrp30 Products

Product Documents for Adiponectin/Acrp30 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Adiponectin/Acrp30 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.