Adrenomedullin R/ADMR/GPR182 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-90231PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-90231PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all Adrenomedullin R/ADMR Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPR182.

Source: E. coli

Amino Acid Sequence: LSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90231.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-90231PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Adrenomedullin R/ADMR

G Protein-Coupled Receptor L1/G10D has been suggested to be an Adrenomedullin Receptor. Originally cloned from rats and later from humans, L1/G10D does not to bind adrenomedullin or display functional cAMP response to adrenomedullin (reviewed in Poyner et al. 2002). The initial experimental results, which demonstrated high-affinity binding and increased levels of cAMP in COS cells that were transfected with L1/G10D and treated with adrenomedullin, could not be reproduced by other laboratories (Kapas et al. 1995). It is now known that the functional adrenomedullin receptor is a heterodimeric complex composed of calcitonin receptor-like receptor (CRLR) and receptor activity modifying proteins (RAMPs) (McLatchie et al. 1998). L1/G10D therefore should be considered an Orphan A receptor. L1/G10D expression has been reported in adrenal gland, bone marrow, brain, heart, kidney, liver, lung, lymph node, pancreas, skeletal muscle, small intestine, spleen, stomach, testis, and thyroid. ESTs have been isolated from kidney, liver/spleen, fetal lung/testis/B-cell, and melanocyte/uterus/fetal heart libraries.

Long Name

Adrenomedullin Receptor

Alternate Names

7TMR, ADMR, AdrenomedullinR, AMR, G10D, GAMRH, Gpcr22, GPR182, MB10, NOW

Gene Symbol

GPR182

Additional Adrenomedullin R/ADMR Products

Product Documents for Adrenomedullin R/ADMR/GPR182 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Adrenomedullin R/ADMR/GPR182 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.