AGAP2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-85686PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-85686PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all AGAP2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AGAP2.

Source: E. coli

Amino Acid Sequence: PSASINGLVKDMSTVQMGEGLEATTPMPSPSPSPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTTPSKTE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85686.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-85686PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: AGAP2

AGAP2 (also known as centaurin-gamma1, ARF-GAP with GTP-binding protein-like, ankyrin repeat and pleckstrin homology domains 2, Phosphatidyl-inositol-3-kinase enhancer, PIKE, GTP-binding and GTPase activating protein 2 and GGAP2) is a GTPase activating protein that inactivates Arf. The expression of AGAP2 is amplified in human glioblastoma cells. AGAP2 protein binds to and activates the protein kinase Akt and prevents apoptosis of cancer cells. AGAP2 also increases motility and invasive activity of cancer cells. AGAP2 may serve as a diagnostic and therapeutic target of human cancer.

Alternate Names

AGAP-2, ArfGAP with GTPase domain, ankyrin repeat and PH domain 2, arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2, centaurin, gamma 1, Centaurin-gamma-1, CENTG1, cnt-g1, FLJ16430, GGAP2, GTP-binding and GTPase activating protein 2, GTP-binding and GTPase-activating protein 2, KIAA0167, Phosphatidylinositol-3-kinase enhancer, phosphoinositide 3-kinase enhancer, PIKEArf GAP with GTP-binding protein-like, ANK repeat and PH domains 2

Gene Symbol

AGAP2

Additional AGAP2 Products

Product Documents for AGAP2 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for AGAP2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.