Aminopeptidase N/CD13 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-33855PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-33855PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all Aminopeptidase N/CD13 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ANPEP.

Source: E. coli

Amino Acid Sequence: PNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33855.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-33855PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Aminopeptidase N/CD13

Alanine aminopeptidase (CD13) is expressed on the majority of peripheral blood monocytes and granulocytes. CD13 is also expressed by the majority of acute myeloid leukemias, chronic myeloid leukemias in myeloid blast crisis, a smaller percentage of lymphoid leukemias and myeloid cell lines. CD13 is also found in several types of non hematopoietic cells such as fibroblasts and endothelial cells and in a soluble form in blood plasma. CD13 is not expressed on B cells, T cells, platelets or erythrocytes. In the mouse, CD13 is a non-covalently linked homodimer of approximately 150kD subunits expressed by a variety of cells including monocytes, macrophages, dendritic cell and veiled cells. CD13 plays a role in biologically active peptide metabolism, in the control of growth and differentiation, in phagocytosis and in bactericidal/tumoricidal activities. CD13 also serves as a receptor for human coronaviruses.

CD13 is commonly used as a biomarker to detect damage to the kidneys, and that may be used to help diagnose certain kidney disorders. Therefore, CD13 antibodies are useful tools for cancer and renal disorder research.

Alternate Names

Aminopeptidase M, ANPEP, APN, CD13, gp150, PEPN

Gene Symbol

ANPEP

Additional Aminopeptidase N/CD13 Products

Product Documents for Aminopeptidase N/CD13 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Aminopeptidase N/CD13 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.