Androgen R/NR3C4 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-55999PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-55999PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all Androgen R/NR3C4 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Androgen R/NR3C4.

Source: E. coli

Amino Acid Sequence: LSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55999.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-55999PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Androgen R/NR3C4

Androgens have a broad range of effects on the appearance and maintenance of male secondary sexual characteristics. Like other members of the steroid superfamily, the androgen receptor (AR) consists of an amino terminal modulating domain, a central DNA binding domain, a hinge region and a carboxy terminal ligand binding domain. The androgen receptor (AR) is a 110 kDa androgen-dependent transcription factor that is a member of the steroid/nuclear receptor gene superfamily. The AR signaling pathway plays a key role in development and function of male reproductive organs, including the prostate and epididymis. AR also plays a role in nonreproductive organs, such as muscle, hair follicles, and brain. Abnormalities in the AR signaling pathway have been linked to a number of diseases, including prostate cancer, Kennedy's disease and male infertility. The PI3K/Akt signaling pathway plays an important role in regulating AR activity through phosphorylation of AR at Ser213/210 and Ser791/790. Growth factors or cytokines may induce phosphorylation of AR through the PI3K/Akt pathway. Activation of the PI3K/AKt pathway is thought to have a survival role in prostate cancer by protecting cells from apoptosis.

Long Name

Androgen Receptor

Alternate Names

AIS, AndrogenR, AR, DHTR, NR3C4, SBMA, SMAX1

Gene Symbol

AR

Additional Androgen R/NR3C4 Products

Product Documents for Androgen R/NR3C4 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Androgen R/NR3C4 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.