BCAP31 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89357PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-89357PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all BAP31 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BCAP31.

Source: E. coli

Amino Acid Sequence: ESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89357.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89357PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: BAP31

BAP31 (B Cell Receptor Associated Protein, 28 kDa) is a multiple membrane spanning protein of the endoplasmic reticulum. It has been shown to form both homo and hetero oligomers with the closely related BAP29, and is a potential apoptotic regulator as a predicted BCL2/BCLXL associated protein. In the C terminal domain of BAP31, there are two identical recognition sites for initiator Caspases 1 and 8 of the programmed death cascade. It is hypothesized that BAP31 plays a role in the transport of selected proteins to the Golgi apparatus. BAP31 has also been shown to control expression of CFTR (cystic fibrosis transmembrane conductance regulator). It is believed that interference with the expression or function of BAP31 in epithelial cells may be a way to circumvent the chloride channel defect in cystic fibrosis.

Long Name

B-cell Receptor-associated Protein 31

Alternate Names

6C6-Ag, BCAP31

Gene Symbol

BCAP31

Additional BAP31 Products

Product Documents for BCAP31 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for BCAP31 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.