Recombinant Human BRCA1 GST (N-Term) Protein

Name: Recombinant Human BRCA1 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00000672-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00000672-P01

Submit a review

Citations (1)

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Immunohistochemistry, Microarray, Western Blot

View all BRCA1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-59 of Human BRCA1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKVLLCCPSWSTVVRS

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human BRCA1 GST (N-Term) Protein

SDS-PAGE: Recombinant Human BRCA1 GST (N-Term) Protein [H00000672-P01]

SDS-Page: Recombinant Human BRCA1 Protein [H00000672-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00000672-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: BRCA1

This gene encodes a nuclear phosphoprotein that plays a role in maintaining genomic stability and acts as a tumor suppressor. The encoded protein combines with other tumor suppressors, DNA damage sensors, and signal transducers to form a large multi-subunit protein complex known as BASC for BRCA1-associated genome surveillance complex. This gene product associates with RNA polymerase II, and through the C-terminal domain, also interacts with histone deacetylase complex. This protein thus plays a role in transcription, DNA repair of double-stranded breaks, and recombination. Mutations in this gene are responsible for approximately 40% of inherited breast cancers and more than 80% of inherited breast and ovarian cancers. Alternative splicing plays a role in modulating the subcellular localization and physiological function of this gene. Many alternatively spliced transcript variants have been described for this gene but only some have had their full-length natures identified. [provided by RefSeq]

Long Name

Breast Cancer 1

Alternate Names

BRCAI, breast and ovarian cancer susceptibility protein 1, breast and ovarian cancer sususceptibility protein, breast cancer 1, early onset, breast cancer type 1 susceptibility protein, EC 6.3.2, EC 6.3.2.-, IRIS, PNCA4, PSCP, subunit 1

Gene Symbol

BRCA1

Additional BRCA1 Products

Product Documents for Recombinant Human BRCA1 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human BRCA1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews