c-Fos Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89065PEP
Key Product Details
Source
Conjugate
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: DLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDL
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
For further blocking peptide related information and a protocol, click here.
Protein / Peptide Type
Formulation, Preparation and Storage
NBP1-89065PEP
Formulation | PBS and 1M Urea, pH 7.4. |
Preservative | No Preservative |
Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: c-Fos
In response to stimuli, c-Fos, which is encoded by protooncogenes, has a role in cell proliferation, differentiation, and transformation (3,6). A variety of stimuli can increase c-Fos expression such as growth factors, proinflammatory cytokines, UV radiation, neurotransmitters, hormones, injury, and stress (1,6). c-Fos has long been used as a marker for neuronal activity and is associated with neural and behavioral responses following stimuli (1-3, 6-7). Mouse studies have revealed that c-Fos is important for efficient neurogenesis and cortical development (3). Additionally, c-Fos signal can be used as a molecular marker for learning and memory, such as recognition and fear (2,7). Studies have found that repeated positive stimuli result in increased Fos expression while, conversely, repeated negative value stimuli are indicated by decreased signal (7). Intermediate early genes have also been implicated in neuropsychiatric disorders including showing altered c-Fos expression in a schizophrenia animal model (2). Furthermore, antipsychotics and antidepressants are both capable of impacting c-Fos expression (2).
References
1. Kovacs K. J. (1998). c-Fos as a transcription factor: a stressful (re)view from a functional map. Neurochemistry International. https://doi.org/10.1016/s0197-0186(98)00023-0
2. Gallo, F. T., Katche, C., Morici, J. F., Medina, J. H., & Weisstaub, N. V. (2018). Immediate Early Genes, Memory and Psychiatric Disorders: Focus on c-Fos, Egr1 and Arc. Frontiers in Behavioral Neuroscience. https://doi.org/10.3389/fnbeh.2018.00079
3. Velazquez, F. N., Caputto, B. L., & Boussin, F. D. (2015). c-Fos importance for brain development. Aging. https://doi.org/10.18632/aging.100862
4. Uniprot (P01100)
5. Wu, Z., Nicoll, M., & Ingham, R. J. (2021). AP-1 family transcription factors: a diverse family of proteins that regulate varied cellular activities in classical hodgkin lymphoma and ALK+ ALCL. Experimental Hematology & Oncology. https://doi.org/10.1186/s40164-020-00197-9
6. Shaulian, E., & Karin, M. (2001). AP-1 in cell proliferation and survival. Oncogene. https://doi.org/10.1038/sj.onc.1204383
7. Chung L. (2015). A Brief Introduction to the Transduction of Neural Activity into Fos Signal. Development & Reproduction. https://doi.org/10.12717/DR.2015.19.2.061
Long Name
Alternate Names
Gene Symbol
Additional c-Fos Products
Product Documents for c-Fos Recombinant Protein Antigen
Product Specific Notices for c-Fos Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.