CD163 Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-49028PEP
Key Product Details
Source
E. coli
Conjugate
Unconjugated
Applications
Antibody Competition
Product Specifications
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD163.
Source: E. coli
Amino Acid Sequence: ACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAVWQCKHHEWGKHYCNHNEDAGVTCSD
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Antibody Competition (10 - 100 molar excess)
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49028.
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Recombinant Protein Antigen
Formulation, Preparation and Storage
NBP2-49028PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: CD163
One of the primary functions of CD163 is uptake of haptoglobin-hemoglobin (Hp-Hb) complexes from the liver, spleen, and bone marrow, ultimately triggering an anti-inflammatory response (3, 5, 7). CD163 also functions as an erythroblast adhesion receptor and promotes cell maturation and survival (3, 5, 7). Furthermore, CD163 functions in immune sensing of bacteria and as a receptor for tumor necrosis factor (TNF)-like weak inducer of apoptosis (TWEAK) (3, 5, 7). As mentioned above, CD163 is expressed on cells in the monocyte/macrophage lineage and, in general, anti-inflammatory signals including glucocorticoids, interleukin (IL)-6, and IL-10 stimulate CD163 synthesis and expression while, conversely, pro-inflammatory signals such as interferon-gamma (INF-gamma), TNF-alpha, and lipopolysaccharide (LPS) downregulate CD163 (3, 5). In addition to membrane-bound form of CD163, the protein can be cleaved by metalloproteinases (MMP) and induced by LPS or phorbol myristate acetate (PMA) to release a soluble form (sCD163) into the plasma (7). Increased levels of sCD163 in the plasma and an increased number of CD163-expressing macrophages at the site of inflammation are associated with a variety of pathologies (3, 5-7). CD163/sCD163 is often increased and a suitable clinical marker for inflammatory diseases including rheumatoid arthritis (RA), Gaucher disease, chronic kidney disease, diabetes, and Crohn's disease (3, 5-7).
Alternative names for CD163 includes GHI/61, HbSR, Hemoglobin scavenger receptor, M130, macrophage-associated antigen, MM130, RM3/1, SCARI1, scavenger receptor cysteine-rich type 1 protein M130, sCD163, and soluble CD163.
References
1. Law, S. K., Micklem, K. J., Shaw, J. M., Zhang, X. P., Dong, Y., Willis, A. C., & Mason, D. Y. (1993). A new macrophage differentiation antigen which is a member of the scavenger receptor superfamily. European journal of immunology. https://doi.org/10.1002/eji.1830230940
2. Onofre, G., Kolackova, M., Jankovicova, K., & Krejsek, J. (2009). Scavenger receptor CD163 and its biological functions. Acta medica (Hradec Kralove).
3. Van Gorp, H., Delputte, P. L., & Nauwynck, H. J. (2010). Scavenger receptor CD163, a Jack-of-all-trades and potential target for cell-directed therapy. Molecular immunology. https://doi.org/10.1016/j.molimm.2010.02.008
4. Sulahian, T. H., Hogger, P., Wahner, A. E., Wardwell, K., Goulding, N. J., Sorg, C., Droste, A., Stehling, M., Wallace, P. K., Morganelli, P. M., & Guyre, P. M. (2000). Human monocytes express CD163, which is upregulated by IL-10 and identical to p155. Cytokine. https://doi.org/10.1006/cyto.2000.0720
5. Etzerodt, A., & Moestrup, S. K. (2013). CD163 and inflammation: biological, diagnostic, and therapeutic aspects. Antioxidants & redox signaling. https://doi.org/10.1089/ars.2012.4834
6. Skytthe, M. K., Graversen, J. H., & Moestrup, S. K. (2020). Targeting of CD163+ Macrophages in Inflammatory and Malignant Diseases. International journal of molecular sciences, 21(15), 5497. https://doi.org/10.3390/ijms21155497
7. Moller H. J. (2012). Soluble CD163. Scandinavian journal of clinical and laboratory investigation. https://doi.org/10.3109/00365513.2011.626868
Alternate Names
CD163, GHI/61, HbSR, M130, RM3/1
Gene Symbol
CD163
Additional CD163 Products
Product Documents for CD163 Recombinant Protein Antigen
Product Specific Notices for CD163 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...