Skip to main content

CD84/SLAMF5 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-49635PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-49635PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD84/SLAMF5.

Source: E. coli

Amino Acid Sequence: RRQGRIFPEDAASKKTIYTYIMASRNTQPAESRIYDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49635.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-49635PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CD84/SLAMF5

CD84 is a 64-82 kD glycoprotein. It is a member of the SLAM (CD150) family, a CD2 subset of the Ig superfamily, also known as SLAMF5 or Ly9b. CD84 is expressed on B cells, monocytes, thymocytes, subset of T cells, and platelets. CD84 functions as a homophilic adhesion molecule and enhances T cell activation and cytokine production. CD84 is expressed on mature B cells and B cell lines but not on plasma cell lines. Immunohistochemical studies demonstrate that it strongly stains tissue macrophages. It is also expressed on platelets and at low levels on blood T cells. Cellular expression does not significantly increase after activation.

Long Name

SLAM Family Member 5

Alternate Names

CD84, Ly-9B, SLAMF5

Gene Symbol

CD84

Additional CD84/SLAMF5 Products

Product Documents for CD84/SLAMF5 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CD84/SLAMF5 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...